PDB entry 6jrl

View 6jrl on RCSB PDB site
Description: Crystal structure of Drosophila alpha methyldopa-resistant protein/3,4-dihydroxyphenylacetaldehyde synthase
Class: oxidoreductase
Keywords: synthase, OXIDOREDUCTASE
Deposited on 2019-04-04, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3,4-dihydroxyphenylacetaldehyde synthase
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: alpha methyldopa-resistant gene
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jrla_
  • Heterogens: LLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6jrlA (A:)
    mdakefrefgkaaidyiadylenirdddvlpnvepgylldllptempeepeawkdvlgdi
    srvikpglthwqsphmhayyptstsypsivgemlasgfgvigfswicspactelevvvmd
    wlakflklpahfqhasdgpgggviqgsaseavlvavlaareqavanyreshpelsesevr
    grlvayssdqsnsciekagvlaampirllpagedfvlrgdtlrgaieedvaagripvicv
    atlgttgtcayddieslsavceefkvwlhvdaayaggafaleecsdlrkgldrvdslnfn
    lhkfmlvnfdcsamwlrdankvvdsfnvdriylkhkhegqsqipdfrhwqiplgrrfral
    kvwitfrtlgaeglrnhvrkhielakqfeqlvlkdsrfelvapralglvcfrpkgdneit
    tqllqrlmdrkkiymvkaehagrqflrfvvcgmdtkasdidfawqeiesqltdlqaeqsl
    varksgnvgdlaqhfqihlstenatheksq
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jrlA (A:)
    mdakefrefgkaaidyiadylenirdddvlpnvepgylldllptempeepeawkdvlgdi
    srvikpglthwqsphmhayyptstsypsivgemlasgfgvigfswicspactelevvvmd
    wlakflklpahfqhasdgpgggviqgsaseavlvavlaareqavanyreshpelsesevr
    grlvayssdqsnsciekagvlaampirllpagedfvlrgdtlrgaieedvaagripvicv
    atlgttgtcayddieslsavceefkvwlhvdaayaggafaleecsdlrkgldrvdslnfn
    lhkfmlvnfdcsamwlrdankvvdsfnqipdfrhwqiplgrrfralkvwitfrtlgaegl
    rnhvrkhielakqfeqlvlkdsrfelvapralglvcfrpkgdneittqllqrlmdrkkiy
    mvkaehagrqflrfvvcgmdtkasdidfawqeiesqltdlqaeqs