PDB entry 6jqx

View 6jqx on RCSB PDB site
Description: Crystal structure of a hydrogenase from Trichosporon moniliiforme
Class: hydrolase
Keywords: Structure function, Salicylate, decarboxylase, HYDROLASE
Deposited on 2019-04-01, released 2020-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-04-01, with a file datestamp of 2020-03-27.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Salicylate decarboxylase
    Species: Cutaneotrichosporon moniliiforme [TaxId:1895941]
    Gene: sdc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CT50 (2-351)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d6jqxa1, d6jqxa2
  • Chain 'B':
    Compound: Salicylate decarboxylase
    Species: Cutaneotrichosporon moniliiforme [TaxId:1895941]
    Gene: sdc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CT50 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d6jqxb1, d6jqxb2
  • Heterogens: SAL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6jqxA (A:)
    gsmrgkvsleeafelpkfaaqtkekaelyiapnnrdryfeeilnpcgnrlelsnkhgigy
    tiysiyspgpqgwteraeceeyarecndyisgeianhkdrmgafaalsmhdpkqaseelt
    rcvkelgflgalvndvqhagpegethifydqpewdifwqtcvdldvpfylhpeppfgsyl
    rnqyegrkyligppvsfangvslhvlgmivngvfdrfpklkvilghlgehipgdfwrieh
    wfehcsrplaksrgdvfaekpllhyfrnniwlttsgnfstetlkfcvehvgaerilfsvd
    spyehidvgcgwyddnakaimeavggekaykdigrdnakklfklgkfydsea
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6jqxB (B:)
    gsmrgkvsleeafelpkfaaqtkekaelyiapnnrdryfeeilnpcgnrlelsnkhgigy
    tiysiyspgpqgwteraeceeyarecndyisgeianhkdrmgafaalsmhdpkqaseelt
    rcvkelgflgalvndvqhagpegethifydqpewdifwqtcvdldvpfylhpeppfgsyl
    rnqyegrkyligppvsfangvslhvlgmivngvfdrfpklkvilghlgehipgdfwrieh
    wfehcsrplaksrgdvfaekpllhyfrnniwlttsgnfstetlkfcvehvgaerilfsvd
    spyehidvgcgwyddnakaimeavggekaykdigrdnakklfklgkfydsea
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jqxB (B:)
    gsmrgkvsleeafelpkfaaqtkekaelyiapnnrdryfeeilnpcgnrlelsnkhgigy
    tiysiyspgpqgwteraeceeyarecndyisgeianhkdrmgafaalsmhdpkqaseelt
    rcvkelgflgalvndvqhagpegethifydqpewdifwqtcvdldvpfylhpeppfgsyl
    rnqyegrkyligppvsfangvslhvlgmivngvfdrfpklkvilghlgehipgdfwrieh
    wfehcsrplaksrgdvfaekpllhyfrnniwlttsgnfstetlkfcvehvgaerilfsvd
    spyehidvgcgwyddnakaimeavggekaykdigrdnakklfklgkfydse