PDB entry 6jqw

View 6jqw on RCSB PDB site
Description: Crystal structure of a hydrogenase from Trichosporon moniliiforme
Class: hydrolase
Keywords: Structure function, Salicylate, decarboxylase, HYDROLASE
Deposited on 2019-04-01, released 2020-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-08, with a file datestamp of 2020-04-03.
Experiment type: XRAY
Resolution: 1.44 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Salicylate decarboxylase
    Species: Cutaneotrichosporon moniliiforme [TaxId:1895941]
    Gene: sdc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CT50 (2-351)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d6jqwa1, d6jqwa2
  • Chain 'B':
    Compound: Salicylate decarboxylase
    Species: Cutaneotrichosporon moniliiforme [TaxId:1895941]
    Gene: sdc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0CT50 (2-351)
      • expression tag (0-1)
    Domains in SCOPe 2.08: d6jqwb1, d6jqwb2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6jqwA (A:)
    gsmrgkvsleeafelpkfaaqtkekaelyiapnnrdryfeeilnpcgnrlelsnkhgigy
    tiysiyspgpqgwteraeceeyarecndyisgeianhkdrmgafaalsmhdpkqaseelt
    rcvkelgflgalvndvqhagpegethifydqpewdifwqtcvdldvpfylhpeppfgsyl
    rnqyegrkyligppvsfangvslhvlgmivngvfdrfpklkvilghlgehipgdfwrieh
    wfehcsrplaksrgdvfaekpllhyfrnniwlttsgnfstetlkfcvehvgaerilfsvd
    spyehidvgcgwyddnakaimeavggekaykdigrdnakklfklgkfydsea
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6jqwB (B:)
    gsmrgkvsleeafelpkfaaqtkekaelyiapnnrdryfeeilnpcgnrlelsnkhgigy
    tiysiyspgpqgwteraeceeyarecndyisgeianhkdrmgafaalsmhdpkqaseelt
    rcvkelgflgalvndvqhagpegethifydqpewdifwqtcvdldvpfylhpeppfgsyl
    rnqyegrkyligppvsfangvslhvlgmivngvfdrfpklkvilghlgehipgdfwrieh
    wfehcsrplaksrgdvfaekpllhyfrnniwlttsgnfstetlkfcvehvgaerilfsvd
    spyehidvgcgwyddnakaimeavggekaykdigrdnakklfklgkfydsea