PDB entry 6jqs

View 6jqs on RCSB PDB site
Description: Structure of Transcription factor, GerE
Class: DNA binding protein
Keywords: GerE, spore, DNA BINDING PROTEIN
Deposited on 2019-04-01, released 2019-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding response regulator
    Species: Paenisporosarcina sp. TG-14 [TaxId:1231057]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JQS (Start-74)
    Domains in SCOPe 2.08: d6jqsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6jqsA (A:)
mlserahhrslltgrereifqllvrdystkdisiqlkisektvrnhisntiqklgvsgrs
qailellrlgelsld

    Sequence, based on observed residues (ATOM records): (download) 
    >6jqsA (A:)
rslltgrereifqllvrdystkdisiqlkisektvrnhisntiqklgvsgrsqailellr
lgelsld