PDB entry 6jqk

View 6jqk on RCSB PDB site
Description: structure of c34m/n36
Deposited on 2019-03-31, released 2020-04-08
The last revision was dated 2020-04-08, with a file datestamp of 2020-04-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'C':
  Compound: c34m
  Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • PDB 6JQK (Start-33)
• Chain 'N':
  Compound: n36
  Species: Human immunodeficiency virus 1, synthetic [TaxId:11676]
  Database cross-references and differences (RAF-indexed):
  • PDB 6JQK (Start-35)
• Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'C':
  Sequence; same for both SEQRES and ATOM records:
  

  >6jqkC (C:)
  waslwnwfnnytslihslieesqnqqekneqell
  

  
  
• Chain 'N':
  Sequence; same for both SEQRES and ATOM records:
  

  >6jqkN (N:)
  sgivqqqnnllraieaqqhllqltvwgikqlqaril