PDB entry 6jqe

View 6jqe on RCSB PDB site
Description: the structural basis of the beta-carbonic anhydrases cafd (wild type) of the filamentous fungus aspergillus fumigatus
Deposited on 2019-03-30, released 2019-08-14
The last revision was dated 2019-10-02, with a file datestamp of 2019-09-27.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase
    Species: Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) [TaxId:330879]
    Gene: AFUA_8G06554
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: carbonic anhydrase
    Species: Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) [TaxId:330879]
    Gene: AFUA_8G06554
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6jqeA (A:)
yqlqplsldsvpwrrqpgqqvlwigcsdsgcdelessglpadeifeyrslgnmmvddlsc
katlgyaldslkirnivicghygchiasgevnaglqkpwssvldtlrsthrrtldsltgt
erdralvelnvleqvhslrqsaeaaealqkqqlniwgmvydkatkrgyqli

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6jqeB (B:)
yqlqplsldsvpwrrqpgqqvlwigcsdsgcdelessglpadeifeyrslgnmmvddlsc
katlgyaldslkirnivicghygchiasgevnaglqkpwssvldtlrsthrrtldsltgt
erdralvelnvleqvhslrqsaeaaealqkqqlniwgmvydkatkrgyqli