PDB entry 6jq8

View 6jq8 on RCSB PDB site
Description: crystal structure of hddc from yersinia pseudotuberculosis complexed with gmp-pn
Deposited on 2019-03-29, released 2020-04-01
The last revision was dated 2020-10-28, with a file datestamp of 2020-10-23.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative 6-deoxy-D-mannoheptose pathway protein
    Species: Yersinia pseudotuberculosis [TaxId:633]
    Gene: hddC
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GNH, CIT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6jq8A (A:)
    mydvvilagglgtrlksvsgdipkpmvdisgkpflyrlmeyledqgvqriilslsykady
    iidsvikdnpvnskvdfiieneplgtggaiknackyieaskfivingdtyceldykkfie
    ssldsdlqisgvevddvcrygsldidhdfhvnsivekgrqgtgiinsgtyilskkiiedy
    phdkfsfeldflpkftgvfkafvtkayfidigipedyykacekfk