PDB entry 6jq4

View 6jq4 on RCSB PDB site
Description: higa escherichia coli-k12
Deposited on 2019-03-28, released 2019-05-01
The last revision was dated 2019-05-29, with a file datestamp of 2019-05-24.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antitoxin higa
    Species: Escherichia coli K-12 [TaxId:83333]
    Gene: higA, ygjM, b3082, JW3053
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6jq4A (A:)
    miaiadilqagekltavapflagiqneeqytqalelvdhlllndpenplldlvcakitaw
    eesapefaefnamaqampggiavirtlmdqygltlsdlpeigsksmvsrvlsgkrkltle
    hakklatrfgispalfid
    

    Sequence, based on observed residues (ATOM records):
    >6jq4A (A:)
    iaiadilqagekltavapflagiqneeqytqalelvdhlllndpenplldlvcakitawe
    esapefaefnamaqampggiavirtlmdqygltlsdlpeigsksmvsrvlsgkrkltleh
    akklatrfgispalfid