PDB entry 6jpp

View 6jpp on RCSB PDB site
Description: solution structure of elmo1 rbd
Deposited on 2019-03-27, released 2020-04-01
The last revision was dated 2020-04-01, with a file datestamp of 2020-03-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: engulfment and cell motility protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: ELMO1, KIAA0281
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92556 (1-113)
      • expression tag (0)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6jppA (A:)
gmpppadivkvaiewpgaypklmeidqkkplsaiikevcdgwslanheyfalqhadssnf
yiteknrneikngtilrlttspaqnaqqlheriqsssmdaklealkdlaslsrd