PDB entry 6jpm

View 6jpm on RCSB PDB site
Description: Crystal Structure of Odorant Binding Protein 4 in the Natural Predator Chrysopa pallens
Class: structural protein
Keywords: Chrysopa pallens (Rambur), odorant binding protein 4, STRUCTURAL PROTEIN
Deposited on 2019-03-27, released 2019-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-30, with a file datestamp of 2019-10-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Odorant binding protein 4
  Species: Chrysopa pallens [TaxId:417485]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0R8PDN4 (1-118)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d6jpma_
• Chain 'B':
  Compound: Odorant binding protein 4
  Species: Chrysopa pallens [TaxId:417485]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A0R8PDN4 (1-118)
    • initiating methionine (0)
  Domains in SCOPe 2.08: d6jpmb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6jpmA (A:)
  mlteaqmastanlmrkmcqpktkvtdeqinnfhkgvfdddkkmmcymnciletmkiikng
  kldmsaveqqmptlpkkyqestkksieecksadtgdkcepaynfakclylsnpemyflp
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6jpmB (B:)
  mlteaqmastanlmrkmcqpktkvtdeqinnfhkgvfdddkkmmcymnciletmkiikng
  kldmsaveqqmptlpkkyqestkksieecksadtgdkcepaynfakclylsnpemyflp