PDB entry 6jp9

View 6jp9 on RCSB PDB site
Description: Crsytal structure of a XMP complexed ATPPase subunit of M. jannaschii GMP synthetase
Class: ligase
Keywords: Purine biosynthesis, Methanocaldococcus jannaschii, GMP synthetase, ATP pyrophosphatase, P-loop, LIGASE
Deposited on 2019-03-26, released 2020-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-04-22, with a file datestamp of 2020-04-17.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GMP synthase [glutamine-hydrolyzing] subunit B
    Species: Methanocaldococcus jannaschii DSM 2661 [TaxId:243232]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jp9a1, d6jp9a2
  • Chain 'B':
    Compound: GMP synthase [glutamine-hydrolyzing] subunit B
    Species: Methanocaldococcus jannaschii DSM 2661 [TaxId:243232]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jp9b1, d6jp9b2
  • Chain 'C':
    Compound: GMP synthase [glutamine-hydrolyzing] subunit B
    Species: Methanocaldococcus jannaschii DSM 2661 [TaxId:243232]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jp9c1, d6jp9c2
  • Chain 'D':
    Compound: GMP synthase [glutamine-hydrolyzing] subunit B
    Species: Methanocaldococcus jannaschii DSM 2661 [TaxId:243232]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jp9d1, d6jp9d2
  • Heterogens: XMP, PGE, MLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6jp9A (A:)
    mfdpkkfideaveeikqqisdrkaiialsggvdssvaavlthkaigdkltavfvdtglmr
    kgereevektfrdklglnlivvdakdrflnalkgvtdpeekrkiigklfidvfeeiaedi
    kaevlvqgtiapdwietqgkikshhnvalphgmvlevveplrelykdevrllakelglpd
    sivyrqpfpgpglavrvlgevteeklnicreanaiveeevkkanldkdlwqyfavvldck
    atgvkgdereynwivalrmvksldamtahvpeipfdllkriskritseipnvarvvfdit
    dkppatiefe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jp9A (A:)
    mfdpkkfideaveeikqqisdrkaiialsggvdssvaavlthkaigdkltavfvdtglmr
    kgereevektfrdklglnlivvdakdrflnalkgvtdpeekrkiigklfidvfeeiaedi
    kaevlvqgtiapdhnvalphgmvlevveplrelykdevrllakelglpdsivyrqpfpgp
    glavrvlgevteeklnicreanaiveeevkkanldkdlwqyfavvldckatgvkgdreyn
    wivalrmvksldamtahvpeipfdllkriskritseipnvarvvfditdkppatiefe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6jp9B (B:)
    mfdpkkfideaveeikqqisdrkaiialsggvdssvaavlthkaigdkltavfvdtglmr
    kgereevektfrdklglnlivvdakdrflnalkgvtdpeekrkiigklfidvfeeiaedi
    kaevlvqgtiapdwietqgkikshhnvalphgmvlevveplrelykdevrllakelglpd
    sivyrqpfpgpglavrvlgevteeklnicreanaiveeevkkanldkdlwqyfavvldck
    atgvkgdereynwivalrmvksldamtahvpeipfdllkriskritseipnvarvvfdit
    dkppatiefe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jp9B (B:)
    fdpkkfideaveeikqqisdrkaiialsggvdssvaavlthkaigdkltavfvdtglmrk
    gereevektfrdklglnlivvdakdrflnalkgvtdpeekrkiigklfidvfeeiaedik
    aevlvqgtiapdwihnvalphgmvlevveplrelykdevrllakelglpdsivyrqpfpg
    pglavrvlgevteeklnicreanaiveeevkkanldkdlwqyfavvldckatgvreynwi
    valrmvksldamtahvpeipfdllkriskritseipnvarvvfditdkppatiefe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6jp9C (C:)
    mfdpkkfideaveeikqqisdrkaiialsggvdssvaavlthkaigdkltavfvdtglmr
    kgereevektfrdklglnlivvdakdrflnalkgvtdpeekrkiigklfidvfeeiaedi
    kaevlvqgtiapdwietqgkikshhnvalphgmvlevveplrelykdevrllakelglpd
    sivyrqpfpgpglavrvlgevteeklnicreanaiveeevkkanldkdlwqyfavvldck
    atgvkgdereynwivalrmvksldamtahvpeipfdllkriskritseipnvarvvfdit
    dkppatiefe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jp9C (C:)
    dpkkfideaveeikqqiialsggvdssvaavthkaigdkltavfvdtglmrkgereevek
    tfrdklglnlivvdakdrflnalkgvtdpeekrkiigklfidvfeeiedilvqgtiavle
    vveplrelykdevrllakelglpdsivyrqpfpgpglavrvlgevteeklnicreanaiv
    eeevkkanldkdlwqyfavvldckatgvkgdereynwivalrmvksldamtahvpeipfd
    llkriskritseipnvarvvfditdkppatiefe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6jp9D (D:)
    mfdpkkfideaveeikqqisdrkaiialsggvdssvaavlthkaigdkltavfvdtglmr
    kgereevektfrdklglnlivvdakdrflnalkgvtdpeekrkiigklfidvfeeiaedi
    kaevlvqgtiapdwietqgkikshhnvalphgmvlevveplrelykdevrllakelglpd
    sivyrqpfpgpglavrvlgevteeklnicreanaiveeevkkanldkdlwqyfavvldck
    atgvkgdereynwivalrmvksldamtahvpeipfdllkriskritseipnvarvvfdit
    dkppatiefe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jp9D (D:)
    mfdpkkfideaveeikqqisdrkaiialsggvdssvaavlthkaigdkltavfvdtglmr
    kgereevektfrdklglnlivvdakdrflnalkgvtdpeekrkiigklfidvfeeiaedi
    kaevlvqgtiapdwhnvalphgmvlevveplrelykdevrllakelglpdsivyrqpfpg
    pglavrvlgevteeklnicreanaiveeevkkanldkdlwqyfavvldckatgvdereyn
    wivalrmvksldamtahvpeipfdllkriskritseipnvarvvfditdkppatiefe