PDB entry 6jp1

View 6jp1 on RCSB PDB site
Description: An X-ray structure of met sperm whale F43Y/T67R myoglobin with Tyr-heme double cross-links
Class: oxygen transport
Keywords: sperm whale, myoglobin, OXYGEN TRANSPORT
Deposited on 2019-03-25, released 2019-05-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-06-19, with a file datestamp of 2019-06-14.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Gene: MB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-150)
    • engineered mutation (42)
    • engineered mutation (66)
  Domains in SCOPe 2.08: d6jp1a_
• Chain 'B':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Gene: MB
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (0-150)
    • engineered mutation (42)
    • engineered mutation (66)
  Domains in SCOPe 2.08: d6jp1b_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6jp1A (A:)
  vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekydrfkhlkteaemkased
  lkkhgvrvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
  gdfgadaqgamnkalelfrkdiaakykelgy
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6jp1B (B:)
  vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekydrfkhlkteaemkased
  lkkhgvrvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
  gdfgadaqgamnkalelfrkdiaakykelgy