SCOPe 2.08: Structural Classification of Proteins

PDB entry 6joh

View 6joh on RCSB PDB site
Description: The crystal of nucleoside diphosphate kinase from Aspergillus flavus
Class: transferase
Keywords: transferase
Deposited on 2019-03-21, released 2020-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-29, with a file datestamp of 2020-01-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6joha_
Chain 'B':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6johb_
Chain 'C':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6johc_
Chain 'D':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6johd_
Chain 'E':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6johe_
Chain 'F':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6johf_
Chain 'G':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6johg_
Chain 'H':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6johh_
Chain 'I':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6johi_
Chain 'J':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6johj_
Chain 'K':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6johk_
Chain 'L':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6johl_
Chain 'M':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6johm_
Chain 'N':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6john_
Chain 'O':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6joho_
Chain 'P':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6johp_
Chain 'Q':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6johq_
Chain 'R':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6johr_
Chain 'S':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6johs_
Chain 'T':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6joht_
Chain 'U':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6johu_
Chain 'V':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6johv_
Chain 'W':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6johw_
Chain 'X':
Compound: Nucleoside diphosphate kinase
Species: Aspergillus flavus NRRL3357 [TaxId:332952]
Gene: AFLA_006300
Database cross-references and differences (RAF-indexed):
- Uniprot B8NQF0
Domains in SCOPe 2.08: d6johx_

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>6johA (A:)
gpmsdeqtfiaikpdgvqrglvgpiisrfenrgfklaalklcspskehleqhyadlsskp
ffpglvsymlsgpivamvwegrevvktgrtilgatnplasapgtirgdfaidvgrnvchg
sdsvenakkeialwfkpeelqkykhsqfdwiyeka