PDB entry 6jnp

View 6jnp on RCSB PDB site
Description: Structure of ExoT-SpcS Complex from Pseudomonas aeruginosa in 2.2 Angstrom
Class: toxin
Keywords: ExoT, SpcS, T3SS, Pseudomonas, Pseudomonas aeruginosa, Toxin, chaperone, Effector, Exotoxin, Effector-toxin
Deposited on 2019-03-17, released 2019-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-04-03, with a file datestamp of 2019-03-29.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Exoenzyme T
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: yopE, NCTC13719_06179
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A379I277 (0-56)
    • conflict (3)
• Chain 'B':
  Compound: CesT family type III secretion system chaperone
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: YERA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q51450 (0-115)
  Domains in SCOPe 2.08: d6jnpb_
• Chain 'C':
  Compound: CesT family type III secretion system chaperone
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: YERA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q51450 (0-115)
  Domains in SCOPe 2.08: d6jnpc_
• Chain 'D':
  Compound: Exoenzyme T
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: yopE, NCTC13719_06179
  Database cross-references and differences (RAF-indexed):
  • Uniprot A0A379I277 (0-56)
    • conflict (3)
• Chain 'E':
  Compound: CesT family type III secretion system chaperone
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: YERA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q51450 (0-115)
  Domains in SCOPe 2.08: d6jnpe_
• Chain 'F':
  Compound: CesT family type III secretion system chaperone
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: YERA
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q51450 (0-115)
  Domains in SCOPe 2.08: d6jnpf_
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6jnpB (B:)
  mnplyraaihqlflaldlptpndeesvlslqvgphlchlaehptdhllmftrlegqgdat
  aneqnlfsqdpckpilgrdpesgerllwnrqplqlldraqihhqleqlvaaaeelr
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6jnpC (C:)
  mnplyraaihqlflaldlptpndeesvlslqvgphlchlaehptdhllmftrlegqgdat
  aneqnlfsqdpckpilgrdpesgerllwnrqplqlldraqihhqleqlvaaaeelr
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6jnpE (E:)
  mnplyraaihqlflaldlptpndeesvlslqvgphlchlaehptdhllmftrlegqgdat
  aneqnlfsqdpckpilgrdpesgerllwnrqplqlldraqihhqleqlvaaaeelr
  

  
  
• Chain 'F':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6jnpF (F:)
  mnplyraaihqlflaldlptpndeesvlslqvgphlchlaehptdhllmftrlegqgdat
  aneqnlfsqdpckpilgrdpesgerllwnrqplqlldraqihhqleqlvaaaeelr