PDB entry 6jno

View 6jno on RCSB PDB site
Description: RXRa structure complexed with CU-6PMN
Class: transcription
Keywords: Retinoid x receptor alpha, Ligand binding domain, fluorescent reagent, inactive form, TRANSCRIPTION
Deposited on 2019-03-17, released 2019-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-11-20, with a file datestamp of 2019-11-15.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jnoc_
  • Chain 'D':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jnod_
  • Heterogens: WY5, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6jnoC (C:)
    gsshssanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftl
    vewakriphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahs
    agvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyas
    leayckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaph
    qmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jnoC (C:)
    pverileaelapvtnicqaadkqlftlvewakriphfselplddqvillragwnellias
    fshrsiavkdgilllhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclraivl
    fnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkcleh
    lfffkligdtpidtflmeml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6jnoD (D:)
    gsshssanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftl
    vewakriphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahs
    agvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyas
    leayckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaph
    qmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jnoD (D:)
    pverileaelandpvtnicqaadkqlftlvewakriphfselplddqvillragwnelli
    asfshrsiavkdgillglhvhrnsahsagvgaifdrvltelvskmrdmqmdktelgclra
    ivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlpalrsiglkc
    lehlfffkligdtpidtflmeml