PDB entry 6jnm

View 6jnm on RCSB PDB site
Description: ref6 znf2-4-nac004-mc3 complex
Deposited on 2019-03-17, released 2019-03-27
The last revision was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Lysine-specific demethylase REF6
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: REF6, JMJ12, PKDM9A, At3g48430, T29H11_50
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9STM3
• Chain 'B':
  Compound: Lysine-specific demethylase REF6
  Species: Arabidopsis thaliana [TaxId:3702]
  Gene: REF6, JMJ12, PKDM9A, At3g48430, T29H11_50
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9STM3
• Chain 'C':
  Compound: DNA (5'-d(*cp*ap*ap*ap*ap*cp*ap*gp*ap*gp*ap*a)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'D':
  Compound: DNA (5'-d(*tp*tp*cp*tp*(5cm)p*tp*gp*tp*tp*tp*tp*g)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'E':
  Compound: DNA (5'-d(*cp*ap*ap*ap*ap*cp*ap*gp*ap*gp*ap*a)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Chain 'F':
  Compound: DNA (5'-d(*tp*tp*cp*tp*(5cm)p*tp*gp*tp*tp*tp*tp*g)-3')
  Species: synthetic construct, synthetic [TaxId:32630]
  
• Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence, based on SEQRES records:
  

  >6jnmA (A:)
  lmlhkrnicpikgcgknffshkylvqhqrvhsddrplkcpwkgckmtfkwawsrtehirv
  htgarpyvcaepdcgqtfrfvsdfsrhkrktghsvkktnkr
  

  
  Sequence, based on observed residues (ATOM records):
  

  >6jnmA (A:)
  rnicpikgcgknffshkylvqhqrvhsddrplkcpwkgckmtfkwawsrtehirvhtgar
  pyvcaepdcgqtfrfvsdfsrhkrktghs
  

  
  
• Chain 'B':
  Sequence, based on SEQRES records:
  

  >6jnmB (B:)
  lmlhkrnicpikgcgknffshkylvqhqrvhsddrplkcpwkgckmtfkwawsrtehirv
  htgarpyvcaepdcgqtfrfvsdfsrhkrktghsvkktnkr
  

  
  Sequence, based on observed residues (ATOM records):
  

  >6jnmB (B:)
  rnicpikgcgknffshkylvqhqrvhsddrplkcpwkgckmtfkwawsrtehirvhtgar
  pyvcaepdcgqtfrfvsdfsrhkrktghs
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.