PDB entry 6jnl

View 6jnl on RCSB PDB site
Description: ref6 znf2-4-nac004 complex
Deposited on 2019-03-17, released 2019-03-27
The last revision was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lysine-specific demethylase REF6
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: REF6, JMJ12, PKDM9A, At3g48430, T29H11_50
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA (5'-d(*cp*ap*ap*ap*ap*cp*ap*gp*ap*gp*a)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'D':
    Compound: DNA (5'-d(*tp*tp*cp*tp*cp*tp*gp*tp*tp*tp*tp*g)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: ZN, MG, GOL, DA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6jnlA (A:)
lmlhkrnicpikgcgknffshkylvqhqrvhsddrplkcpwkgckmtfkwawsrtehirv
htgarpyvcaepdcgqtfrfvsdfsrhkrktghsvkktnkr

    Sequence, based on observed residues (ATOM records):
    >6jnlA (A:)
rnicpikgcgknffshkylvqhqrvhsddrplkcpwkgckmtfkwawsrtehirvhtgar
pyvcaepdcgqtfrfvsdfsrhkrktghs

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.