PDB entry 6jn6

View 6jn6 on RCSB PDB site
Description: Metallo-Beta-Lactamase VIM-2 in complex with Dual MBL/SBL Inhibitor MS19
Class: hydrolase
Keywords: Metallo-beta-lactamase VIM-2, VIM-2, HYDROLASE
Deposited on 2019-03-13, released 2019-07-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: beta-lactamase class b vim-2
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: blaVIM-2, bla vim-2, bla-VIM-2, blasVIM-2, blaVIM2, blm, VIM-2, vim-2, PAERUG_P32_London_17_VIM_2_10_11_06255
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9K2N0 (0-230)
  Domains in SCOPe 2.08: d6jn6a_
• Chain 'B':
  Compound: beta-lactamase class b vim-2
  Species: Pseudomonas aeruginosa [TaxId:287]
  Gene: blaVIM-2, bla vim-2, bla-VIM-2, blasVIM-2, blaVIM2, blm, VIM-2, vim-2, PAERUG_P32_London_17_VIM_2_10_11_06255
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9K2N0 (0-230)
  Domains in SCOPe 2.08: d6jn6b_
• Heterogens: BY0, ZN, FMT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6jn6A (A:)
  eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
  taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
  thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
  adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnr
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6jn6B (B:)
  eyptvseipvgevrlyqiadgvwshiatqsfdgavypsnglivrdgdelllidtawgakn
  taallaeiekqiglpvtravsthfhddrvggvdvlraagvatyaspstrrlaevegneip
  thsleglsssgdavrfgpvelfypgaahstdnlvvyvpsasvlyggcaiyelsrtsagnv
  adadlaewptsieriqqhypeaqfvipghglpggldllkhttnvvkahtnr