PDB entry 6jmv

View 6jmv on RCSB PDB site
Description: Crystal structure of the GluK3 ligand binding domain complex with SYM and zinc
Class: membrane protein
Keywords: Glutamate receptor, Kainate, SYM, MEMBRANE PROTEIN
Deposited on 2019-03-13, released 2019-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamate receptor ionotropic, kainate 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Grik3, Glur7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42264 (2-115)
      • expression tag (0-1)
      • linker (116-117)
    • Uniprot P42264 (118-End)
    Domains in SCOPe 2.07: d6jmva1, d6jmva2
  • Chain 'B':
    Compound: Glutamate receptor ionotropic, kainate 3
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Grik3, Glur7
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42264 (2-115)
      • linker (116-117)
    • Uniprot P42264 (118-End)
    Domains in SCOPe 2.07: d6jmvb_
  • Heterogens: SYM, CL, ZN, GOL, ACT, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6jmvA (A:)
    gsnrslivttlleepfvmfrksdrtlygndrfegycidllkelahilgfsyeirlvedgk
    ygaqddkgqwngmvkelidhkadlavapltithvrekaidfskpfmtlgvsilyrkgtpi
    dsaddlakqtkieygavkdgatmtffkkskistfekmwafmsskpsalvknneegiqrtl
    tadyallmesttieyitqrncnltqigglidskgygigtpmgspyrdkitiailqlqeed
    klhimkekwwrgsgcpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jmvA (A:)
    gsnrslivttlleepfvmfrksdrtlygndrfegycidllkelahilgfsyeirlvedgk
    ygaqddkgqwngmvkelidhkadlavapltithvrekaidfskpfmtlgvsilyrkgtpi
    dsaddlakqtkieygavkdgatmtffkkskistfekmwafmsskpsalvknneegiqrtl
    tadyallmesttieyitqrncnltqigglidskgygigtpmgspyrdkitiailqlqeed
    klhimkekwwrgsgcp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6jmvB (B:)
    gsnrslivttlleepfvmfrksdrtlygndrfegycidllkelahilgfsyeirlvedgk
    ygaqddkgqwngmvkelidhkadlavapltithvrekaidfskpfmtlgvsilyrkgtpi
    dsaddlakqtkieygavkdgatmtffkkskistfekmwafmsskpsalvknneegiqrtl
    tadyallmesttieyitqrncnltqigglidskgygigtpmgspyrdkitiailqlqeed
    klhimkekwwrgsgcpe
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jmvB (B:)
    nrslivttlleepfvmfrksdrtlygndrfegycidllkelahilgfsyeirlvedgkyg
    aqddkgqwngmvkelidhkadlavapltithvrekaidfskpfmtlgvsilyrkgtpids
    addlakqtkieygavkdgatmtffkkskistfekmwafmsskpsalvknneegiqrtlta
    dyallmesttieyitqrncnltqigglidskgygigtpmgspyrdkitiailqlqeedkl
    himkekwwrgsgc