PDB entry 6jmn

View 6jmn on RCSB PDB site
Description: crystal structure of ostrinia furnacalis chitinase h complexed with compound 2-8-s2
Deposited on 2019-03-12, released 2020-05-06
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase
    Species: Ostrinia furnacalis [TaxId:93504]
    Gene: OfChi-h
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BV0, NAG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6jmnA (A:)
    mgrlaivvvatlalaaaappgkpslgwgertfaivevnqaataynqlvtkrdsadvsvtw
    nvwsgdpadkarvllndkefwsgtggaagsasfkvkkggryqmvvelcnadgcsqsdate
    iivadtdgshlppldynmgeknkpfkqtsgkvvgayfvewgvyprkfpvdrvpipnlthl
    lygfipicggdgindslkeiegsfqalqrscsgredfkvsihdpwaalqkpqkglsswne
    pykgnfgqlmmlkqakpdlkilpsiggwtladpfffftdetkrrrfvasvkdflqtwkff
    dgvdidwefpggkganpnlgspkdgeiyvllmkelremlnelsaetgrkyeltsaisagw
    dkiqvvdysaaqkymdhiffmsydfkgawsndtlghqaslyapdwneketyttdfgvqfl
    laqgvspkkivvgvamygrgwtgvhgykdnnpftgnatgpvkgtwqdgvvdyreiateia
    qgkweyhydkvaqapyvfrpatgdlityddarstiekgkyvranklgglfaweidadngd
    ilnamnmglgnsa
    

    Sequence, based on observed residues (ATOM records):
    >6jmnA (A:)
    appgkpslgwgertfaivevnqaataynqlvtkrdsadvsvtwnvwsgdpadkarvllnd
    kefwsgtggaagsasfkvkkggryqmvvelcnadgcsqsdateiivadtdgshlppldyn
    mgeknkpfkqtsgkvvgayfvewgvyprkfpvdrvpipnlthllygfipicggdgindsl
    keiegsfqalqrscsgredfkvsihdpwaalqkpqkglsswnepykgnfgqlmmlkqakp
    dlkilpsiggwtladpfffftdetkrrrfvasvkdflqtwkffdgvdidwefpggkganp
    nlgspkdgeiyvllmkelremlnelsaetgrkyeltsaisagwdkiqvvdysaaqkymdh
    iffmsydfkgawsndtlghqaslyapdwneketyttdfgvqfllaqgvspkkivvgvamy
    grgwtgvhgykdnnpftgnatgpvkgtwqdgvvdyreiateiaqgkweyhydkvaqapyv
    frpatgdlityddarstiekgkyvranklgglfaweidadngdilnamnmglgnsa