PDB entry 6jmj

View 6jmj on RCSB PDB site
Description: crystal structure of the complex of phospho pantetheine adenylyl transferase from acinetobacter baumannii with ascorbic acid (vitamin- c) at 2.19 a resolution.
Deposited on 2019-03-11, released 2019-03-20
Made obsolete by 6kyg on 2019-10-09

The last revision was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: coaD
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ASC, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6jmjA (A:)
msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl
ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt
pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw