The last revision was dated 2019-10-09, with a file datestamp of 2019-10-04.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)
Chains and heterogens:
PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.
>6jmjA (A:) msktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqssl ghlsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavflt pseqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw