PDB entry 6jly

View 6jly on RCSB PDB site
Description: eif2a - eif2b complex
Deposited on 2019-03-07, released 2019-05-01
The last revision was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Translation initiation factor eIF-2B subunit alpha
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: tif221, SPCC11E10.07c
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Translation initiation factor eIF-2B subunit alpha
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: tif221, SPCC11E10.07c
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Probable translation initiation factor eIF-2B subunit beta
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: tif222, SPAC343.14c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UT76 (6-398)
      • expression tag (0-5)
  • Chain 'D':
    Compound: Probable translation initiation factor eIF-2B subunit beta
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: tif222, SPAC343.14c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UT76 (6-398)
      • expression tag (0-5)
  • Chain 'E':
    Compound: Probable translation initiation factor eIF-2B subunit gamma
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: tif223, SPAC4D7.09
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56288
      • conflict (156-158)
  • Chain 'F':
    Compound: Probable translation initiation factor eIF-2B subunit gamma
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: tif223, SPAC4D7.09
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56288
      • conflict (156-158)
  • Chain 'G':
    Compound: Probable translation initiation factor eIF-2B subunit delta
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: tif224, SPAC21E11.06
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Probable translation initiation factor eIF-2B subunit delta
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: tif224, SPAC21E11.06
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Probable translation initiation factor eIF-2B subunit epsilon
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: tif225, SPAC8C9.15c
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Probable translation initiation factor eIF-2B subunit epsilon
    Species: Schizosaccharomyces pombe (strain 972 / ATCC 24843) [TaxId:284812]
    Gene: tif225, SPAC8C9.15c
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Eukaryotic translation initiation factor 2 subunit alpha
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SUI2, TIF211, YJR007W, J1429
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: Eukaryotic translation initiation factor 2 subunit alpha
    Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [TaxId:559292]
    Gene: SUI2, TIF211, YJR007W, J1429
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6jlyA (A:)
    mvesdssgivrhsqgefdivqvykkflqddpeitmpvaaiealvqllsrsqaktisefmd
    ilqngsntlkegvqnnislsagcdifqrfvtrslhdvgdfeqckrhlvengklfiqrara
    crqriahlgyplirdgsvilthgfsrgvaavllaaakrhvrfkvfvtesrpsgsgclmtr
    tlknaciptcmvldsavsftmnrvdlvlvgaegvvengglinqigtfqlavfakhahkpf
    yavaeshkfvrmfplsqydipfsrpilefddpspetvhpepepiptpsdaihnelimnee
    qirnnptldvtppefvsglitdlgiidsksgvseeliklyl
    

    Sequence, based on observed residues (ATOM records):
    >6jlyA (A:)
    gefdivqvykkflqddpeitmpvaaiealvqllsrsqaktisefmdilqngsntlkegvq
    nnislsagcdifqrfvtrslhdvgdfeqckrhlvengklfiqraracrqriahlgyplir
    dgsvilthgfsrgvaavllaaakrhvrfkvfvtesrpsgsgclmtrtlknaciptcmvld
    savsftmnrvdlvlvgaegvvengglinqigtfqlavfakhahkpfyavaeshkfvrmfp
    lsqydipfsrpilefddpspetvhaihnelimneeqirnnptldvtppefvsglitdlgi
    idsksgvseeliklyl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6jlyB (B:)
    mvesdssgivrhsqgefdivqvykkflqddpeitmpvaaiealvqllsrsqaktisefmd
    ilqngsntlkegvqnnislsagcdifqrfvtrslhdvgdfeqckrhlvengklfiqrara
    crqriahlgyplirdgsvilthgfsrgvaavllaaakrhvrfkvfvtesrpsgsgclmtr
    tlknaciptcmvldsavsftmnrvdlvlvgaegvvengglinqigtfqlavfakhahkpf
    yavaeshkfvrmfplsqydipfsrpilefddpspetvhpepepiptpsdaihnelimnee
    qirnnptldvtppefvsglitdlgiidsksgvseeliklyl
    

    Sequence, based on observed residues (ATOM records):
    >6jlyB (B:)
    gefdivqvykkflqddpeitmpvaaiealvqllsrsqaktisefmdilqngsntlkegvq
    nnislsagcdifqrfvtrslhdvgdfeqckrhlvengklfiqraracrqriahlgyplir
    dgsvilthgfsrgvaavllaaakrhvrfkvfvtesrpsgsgclmtrtlknaciptcmvld
    savsftmnrvdlvlvgaegvvengglinqigtfqlavfakhahkpfyavaeshkfvrmfp
    lsqydipfsrpilefddpspetvdaihnelimneeqirnnptldvtppefvsglitdlgi
    idsksgvseeliklyl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6jlyC (C:)
    gpisefmstinvehtypavssliadlksrkvqgpfavavetalvmrqvisqtrwstvdql
    idtvravgstlvkaqptefscgniirrilrlireeyqellktadeneklivsssnsssps
    qkrdipsneklvqshepvsvqmyssmlnllgrptlespthsktvgdsrvtggmdmravii
    sgiqdvideldkintdievqsmdhlhsneiiltqgcsktveaflrfaakkrkfsvivaeg
    fpnnqkgshamakrlaqagidttvisdatifaimsrvnkvilgthailgngglvtysgaq
    lvaqaarhhatpvvvcsgiyklspvypydlesiiqlsspdkimsfnegdlisraeilnpy
    ydyippdlvdlfitnlggyppsylyrimndtydasdtil
    

    Sequence, based on observed residues (ATOM records):
    >6jlyC (C:)
    gpisefmstinvehtypavssliadlksrkvqgpfavavetalvmrqvisqtrwstvdql
    idtvravgstlvkaqptefscgniirrilrlireeyqellktadeneklggmdmraviis
    giqdvideldkintdievqsmdhlhsneiiltqgcsktveaflrfaakkrkfsvivaegf
    pnnqkgshamakrlaqagidttvisdatifaimsrvnkvilgthailgngglvtysgaql
    vaqaarhhatpvvvcsgiyklspvypydlesiiqlsspdkimsfnegdlisraeilnpyy
    dyippdlvdlfitnlggyppsylyrimndtydasdtil
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >6jlyD (D:)
    gpisefmstinvehtypavssliadlksrkvqgpfavavetalvmrqvisqtrwstvdql
    idtvravgstlvkaqptefscgniirrilrlireeyqellktadeneklivsssnsssps
    qkrdipsneklvqshepvsvqmyssmlnllgrptlespthsktvgdsrvtggmdmravii
    sgiqdvideldkintdievqsmdhlhsneiiltqgcsktveaflrfaakkrkfsvivaeg
    fpnnqkgshamakrlaqagidttvisdatifaimsrvnkvilgthailgngglvtysgaq
    lvaqaarhhatpvvvcsgiyklspvypydlesiiqlsspdkimsfnegdlisraeilnpy
    ydyippdlvdlfitnlggyppsylyrimndtydasdtil
    

    Sequence, based on observed residues (ATOM records):
    >6jlyD (D:)
    gpisefmstinvehtypavssliadlksrkvqgpfavavetalvmrqvisqtrwstvdql
    idtvravgstlvkaqptefscgniirrilrlireeyqellktadenekggmdmraviisg
    iqdvideldkintdievqsmdhlhsneiiltqgcsktveaflrfaakkrkfsvivaegfp
    nnqkgshamakrlaqagidttvisdatifaimsrvnkvilgthailgngglvtysgaqlv
    aqaarhhatpvvvcsgiyklspvypydlesiiqlsspdkimsfnegdlisraeilnpyyd
    yippdlvdlfitnlggyppsylyrimndtydasdtil
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >6jlyE (E:)
    mslyehaalplasspsilgpisggrnrgniqlqsipiefqavvfagfgnslypltgsdal
    pkallpignkpmlhyplywleaagftsailicmeeaeahinawlrsgyeghmrihveapt
    ilddskssadalravshlikndfvclscdsivglppytvldkfrldnpsalavyspvlky
    ehitsqskeidakqligieektsrllyakssadvgsdftfrmsllwkhprvtlntnlsda
    hifvfkhwvidlirekesissirgdlipylvkcqyqksftvreniqrflsspnnidnydg
    glssqeikinaliakdgiicsrannlpnyfelnkciakltpeqrlvdvtvseralvgadc
    mvnegttikdnsnikksiigkncvigkgvvvsnsilmdnivvedgvrlescivasgaqig
    aksklreceigvdhrveagriargerlvdmekietdmd
    

    Sequence, based on observed residues (ATOM records):
    >6jlyE (E:)
    gniqlqsipiefqavvfagfgnslypltgsdalpkallpignkpmlhyplywleaagfts
    ailicmeeaeahinawlrsgyeghmrihveaptilddskssadalravshlikndfvcls
    cdsivglppytvldkfrldnpsalavyspvlkyehitsqskeidakqligieektsrlly
    akssadvgsdftfrmsllwkhprvtlntnlsdahifvfkhwvidlirekesissirgdli
    pylvkcqyqksftvreniqrflsspssqeikinaliakdgiicsrannlpnyfelnkcia
    kltpeqrlvdvtvseralvgadcmvnegttikdnsnikksiigkncvigkgvvvsnsilm
    dnivvedgvrlescivasgaqigaksklreceigvdhrveagriargerlvdme
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >6jlyF (F:)
    mslyehaalplasspsilgpisggrnrgniqlqsipiefqavvfagfgnslypltgsdal
    pkallpignkpmlhyplywleaagftsailicmeeaeahinawlrsgyeghmrihveapt
    ilddskssadalravshlikndfvclscdsivglppytvldkfrldnpsalavyspvlky
    ehitsqskeidakqligieektsrllyakssadvgsdftfrmsllwkhprvtlntnlsda
    hifvfkhwvidlirekesissirgdlipylvkcqyqksftvreniqrflsspnnidnydg
    glssqeikinaliakdgiicsrannlpnyfelnkciakltpeqrlvdvtvseralvgadc
    mvnegttikdnsnikksiigkncvigkgvvvsnsilmdnivvedgvrlescivasgaqig
    aksklreceigvdhrveagriargerlvdmekietdmd
    

    Sequence, based on observed residues (ATOM records):
    >6jlyF (F:)
    gniqlqsipiefqavvfagfgnslypltgsdalpkallpignkpmlhyplywleaagfts
    ailicmeeaeahinawlrsgyeghmrihveaptilddskssadalravshlikndfvcls
    cdsivglppytvldkfrldnpsalavyspvlkyehitsqskeidakqligieektsrlly
    akssadvgsdftfrmsllwkhprvtlntnlsdahifvfkhwvidlirekesissirgdli
    pylvkcqyqksftvreniqrflsspqeikinaliakdgiicsrannlpnyfelnkciakl
    tpeqrlvdvtvseralvgadcmvnegttikdnsnikksiigkncvigkgvvvsnsilmdn
    ivvedgvrlescivasgaqigaksklreceigvdhrveagriargerlvdme
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >6jlyG (G:)
    mgfsaeqakkdgkdqspvsesssvggtspatassvvspnepklsgkeakalkkarkqasr
    rakaeaaaannppgvseekkvaipnknsnqqkkaskqnpqnspetdanlqekkifeekqv
    sifshldwrrrrttenipkdihpavirlglklanykifgsnqrcidllktfkiviqdyqt
    pygttlsrhltthinsqiaylvstrplsismgnairflkleisvldidltddegkellle
    kidsyirdriiiagqvivqaatekiqdgdviltylhsstvndvlihaknvgkkfrvvvvd
    srpefegrvclklltehgiectyvmisalsyimqevtkiflgghamlsngalysragtsl
    isllghesnvpviaccesykfteriqldslvynelapgdqlvnmgvddfeekpgvlanwk
    svknlkllslkydvtpprlitvcvcemgllpstsvpaiinefkqvya
    

    Sequence, based on observed residues (ATOM records):
    >6jlyG (G:)
    tdanlqekkifeekqvsifshldwrrrrttenipkdihpavirlglklanykifgsnqrc
    idllktfkiviqdyqtpygttlsrhltthinsqiaylvstrplsismgnairflkleisv
    ldidltddegkelllekidsyirdriiiagqvivqaatekiqdgdviltylhsstvndvl
    ihaknvgkkfrvvvvdsrpefegrvclklltehgiectyvmisalsyimqevtkiflggh
    amlsngalysragtslisllghesnvpviaccesykfteriqldslvynelapgdqlvnm
    gvddfeekpgvlanwksvknlkllslkydvtpprlitvcvcemgllpstsvpaiinefkq
    vya
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >6jlyH (H:)
    mgfsaeqakkdgkdqspvsesssvggtspatassvvspnepklsgkeakalkkarkqasr
    rakaeaaaannppgvseekkvaipnknsnqqkkaskqnpqnspetdanlqekkifeekqv
    sifshldwrrrrttenipkdihpavirlglklanykifgsnqrcidllktfkiviqdyqt
    pygttlsrhltthinsqiaylvstrplsismgnairflkleisvldidltddegkellle
    kidsyirdriiiagqvivqaatekiqdgdviltylhsstvndvlihaknvgkkfrvvvvd
    srpefegrvclklltehgiectyvmisalsyimqevtkiflgghamlsngalysragtsl
    isllghesnvpviaccesykfteriqldslvynelapgdqlvnmgvddfeekpgvlanwk
    svknlkllslkydvtpprlitvcvcemgllpstsvpaiinefkqvya
    

    Sequence, based on observed residues (ATOM records):
    >6jlyH (H:)
    tdanlqekkifeekqvsifshldwrrrrttenipkdihpavirlglklanykifgsnqrc
    idllktfkiviqdyqtpygttlsrhltthinsqiaylvstrplsismgnairflkleisv
    ldidltddegkelllekidsyirdriiiagqvivqaatekiqdgdviltylhsstvndvl
    ihaknvgkkfrvvvvdsrpefegrvclklltehgiectyvmisalsyimqevtkiflggh
    amlsngalysragtslisllghesnvpviaccesykfteriqldslvynelapgdqlvnm
    gvddfeekpgvlanwksvknlkllslkydvtpprlitvcvcemgllpstsvpaiinefkq
    vya
    

  • Chain 'I':
    Sequence, based on SEQRES records:
    >6jlyI (I:)
    mppskglngklekpkhalqaivlsdsynyrfrpltldkprcllplantplieytfeflal
    agvqevyvfccahagqireyiekskwnlpsspfsvntivsreslsvgdalreldskqlit
    sdfilvsgdvvsnvplnevlkehrkrreddknaimtmvvreaspfhrtrartessvfvid
    kktsqcvhyqanergkhyvsmdpeifneheelevrndlidcqidicsndvpalftenfdy
    qdirkdfvygvltsdllgkkihchvakenyaarvrslqtydaiskdvlsrwvypfvpdsn
    llnqtfsyqrhqiykeedvvlarsciikartligaytkvgdasvvantiigrnctigsnc
    sidsaflwedvvigdncrigkailansvkignncsiedgaivaagvvigdntiieknkrl
    ttfeshsqgtlndpslvgiggrgqeyhaeedsddegefmeasgliestnelhlsdsesse
    tsssseedmefipfsarrdsantinsedfdegdfnkeaqqslerafeenhqidiaaleln
    tlrmamnanyhevrsaivlallrrimhldvspkealakvmtrwgpllakltfsheeqvdn
    vltlqkycvrlsmtrhflqllgyfyqleiaeenaiqewysdprssegelaalrdaggkqf
    vdwlntaeseseseegse
    

    Sequence, based on observed residues (ATOM records):
    >6jlyI (I:)
    khalqaivlsdsynyrfrpltldkprcllplantplieytfeflalagvqevyvfccaha
    gqireyiekskwnlpsspfsvntivsreslsvgdalreldskqlitsdfilvsgdvvsnv
    plnevlkehrkrreddknaimtmvvreaspfhrtrartessvfvidkktsqcvhyqaner
    gkhyvsmdpeifneheelevrndlidcqidicsndvpalftenfdyqdirkdfvygvlts
    dllgkkihchvakenyaarvrslqtydaiskdvlsrwvypfvpdsnllnqtfsyqrhqiy
    keedvvlarsciikartligaytkvgdasvvantiigrnctigsncsidsaflwedvvig
    dncrigkailansvkignncsiedgaivaagvvigdntiieknkrlttfeshsqgtlndp
    slvgiggr
    

  • Chain 'J':
    Sequence, based on SEQRES records:
    >6jlyJ (J:)
    mppskglngklekpkhalqaivlsdsynyrfrpltldkprcllplantplieytfeflal
    agvqevyvfccahagqireyiekskwnlpsspfsvntivsreslsvgdalreldskqlit
    sdfilvsgdvvsnvplnevlkehrkrreddknaimtmvvreaspfhrtrartessvfvid
    kktsqcvhyqanergkhyvsmdpeifneheelevrndlidcqidicsndvpalftenfdy
    qdirkdfvygvltsdllgkkihchvakenyaarvrslqtydaiskdvlsrwvypfvpdsn
    llnqtfsyqrhqiykeedvvlarsciikartligaytkvgdasvvantiigrnctigsnc
    sidsaflwedvvigdncrigkailansvkignncsiedgaivaagvvigdntiieknkrl
    ttfeshsqgtlndpslvgiggrgqeyhaeedsddegefmeasgliestnelhlsdsesse
    tsssseedmefipfsarrdsantinsedfdegdfnkeaqqslerafeenhqidiaaleln
    tlrmamnanyhevrsaivlallrrimhldvspkealakvmtrwgpllakltfsheeqvdn
    vltlqkycvrlsmtrhflqllgyfyqleiaeenaiqewysdprssegelaalrdaggkqf
    vdwlntaeseseseegse
    

    Sequence, based on observed residues (ATOM records):
    >6jlyJ (J:)
    khalqaivlsdsynyrfrpltldkprcllplantplieytfeflalagvqevyvfccaha
    gqireyiekskwnlpsspfsvntivsreslsvgdalreldskqlitsdfilvsgdvvsnv
    plnevlkehrkrreddknaimtmvvreaspfhrtrartessvfvidkktsqcvhyqaner
    gkhyvsmdpeifneheelevrndlidcqidicsndvpalftenfdyqdirkdfvygvlts
    dllgkkihchvakenyaarvrslqtydaiskdvlsrwvypfvpdsnllnqtfsyqrhqiy
    keedvvlarsciikartligaytkvgdasvvantiigrnctigsncsidsaflwedvvig
    dncrigkailansvkignncsiedgaivaagvvigdntiieknkrlttfeshsqgtlndp
    slvgig
    

  • Chain 'L':
    Sequence, based on SEQRES records:
    >6jlyL (L:)
    mstshcrfyenkypeiddivmvnvqqiaemgayvklleydniegmillselsrrrirsiq
    klirvgkndvavvlrvdkekgyidlskrrvssediikceekyqksktvhsilrycaekfq
    ipleelyktiawplsrkfghayeafklsiidetvwegieppskdvldelknyiskrltpq
    avkiradvevscfsyegidaikdalksaedmsteqmqvkvklvaaplyvlttqaldkqkg
    ieqlesaiekitevitkyggvcnitmppkavtatedaelqalleskeldnrsdseddede
    sdde
    

    Sequence, based on observed residues (ATOM records):
    >6jlyL (L:)
    stshcrfyenkypeiddivmvnvqqiaemgayvklleydniegmillselsrsiqklirv
    gkndvavvlrvdkekgyidlskrrvssediikceekyqksktvhsilrycaeeelyktia
    wplsrkfghayeafklsiidetvwegieppskdvldelknyiskr
    

  • Chain 'M':
    Sequence, based on SEQRES records:
    >6jlyM (M:)
    mstshcrfyenkypeiddivmvnvqqiaemgayvklleydniegmillselsrrrirsiq
    klirvgkndvavvlrvdkekgyidlskrrvssediikceekyqksktvhsilrycaekfq
    ipleelyktiawplsrkfghayeafklsiidetvwegieppskdvldelknyiskrltpq
    avkiradvevscfsyegidaikdalksaedmsteqmqvkvklvaaplyvlttqaldkqkg
    ieqlesaiekitevitkyggvcnitmppkavtatedaelqalleskeldnrsdseddede
    sdde
    

    Sequence, based on observed residues (ATOM records):
    >6jlyM (M:)
    stshcrfyenkypeiddivmvnvqqiaemgayvklleydniegmillselirsiqklirv
    gkndvavvlrvdkekgyidlskrrvssediikceekyqksktvhsilrycaeleelykti
    awplsrkfghayeafklsiidetvwegieppskdvldelknyiskr