PDB entry 6jlt

View 6jlt on RCSB PDB site
Description: the partially disordered conformation of ubiquitin (q41n variant)
Deposited on 2019-03-06, released 2019-03-20
Made obsolete by 6k4i on 2019-10-30

The last revision was dated 2019-10-30, with a file datestamp of 2019-10-25.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ubiquitin
  Species: Homo sapiens [TaxId:9606]
  Gene: UBB
  Database cross-references and differences (RAF-indexed):
  • Uniprot J3QS39 (0-75)
    • engineered mutation (40)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records:
  

  >6jltA (A:)
  mqifvktltgktitlevepsdtienvkakiqdkegippdqnrlifagkqledgrtlsdyn
  iqkestlhlvlrlrgg