PDB entry 6jli

View 6jli on RCSB PDB site
Description: Crystal structure of CTLD7 domain of human PLA2R
Class: immune system
Keywords: IMN, Epitope, PLA2R, CTLD7, IMMUNE SYSTEM
Deposited on 2019-03-06, released 2019-07-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Secretory phospholipase A2 receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: PLA2R1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jlia_
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6jliA (A:)
ntsdmypmpntleygnrtykiinanmtwyaaiktclmhkaqlvsitdqyhqsfltvvlnr
lgyahwiglfttdnglnfdwsdgtkssftfwkdeessllgdcvfadsngrwhstacesfl
qgaichvhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >6jliA (A:)
ntleygnrtykiinanmtwyaaiktclmhkaqlvsitdqyhqsfltvvlnrlgyahwigl
fttdnglnfdwsdgtkssftfwkdeessllgdcvfadsngrwhstacesflqgaichv