PDB entry 6jle

View 6jle on RCSB PDB site
Description: crystal structure of morn4/myo3a complex
Deposited on 2019-03-05, released 2019-07-24
The last revision was dated 2019-09-18, with a file datestamp of 2019-09-13.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MORN repeat-containing protein 4
    Species: Mus musculus [TaxId:10090]
    Gene: Morn4
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Myosin-IIIa
    Species: Homo sapiens [TaxId:9606]
    Gene: MYO3A
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NEV4 (2-49)
      • expression tag (0-1)
  • Heterogens: GOL, CIT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6jleA (A:)
mtltkgsftyssgeeyrgewkegrrhgfgqlvfadggtylghfenglfngfgvltfsdgs
ryegefsqgkfngvgvfirydnmtfegefkngrvdgfglltfpdgshgiprneglfennk
llrrekcsavvqraqsasksarnlta

    Sequence, based on observed residues (ATOM records):
    >6jleA (A:)
ltkgsftyssgeeyrgewkegrrhgfgqlvfadggtylghfenglfngfgvltfsdgsry
egefsqgkfngvgvfirydnmtfegefkngrvdgfglltfpdgshgiprneglfennkll
rrekcsavvqraqsasksarnlta

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >6jleE (E:)
gsdnkdskatsereacglaifskqisklseeyfilqkklnemilsqqlks