PDB entry 6jl3

View 6jl3 on RCSB PDB site
Description: Crystal Structure of the UBL domain of Plasmodium Falciparum Dsk2
Class: signaling protein
Keywords: Ubiquitin binding, shuttle factor, ubiquitin, SIGNALING PROTEIN
Deposited on 2019-03-03, released 2020-02-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-03-04, with a file datestamp of 2020-02-28.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin domain-containing protein DSK2,putative
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: PF3D7_1113400
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jl3a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6jl3A (A:)
mamvinvsfkvtggkeftvaiepditvldlkkicaehvdipveaqriifkgkilkdkesl
tlygvadgntmhlvrsama

    Sequence, based on observed residues (ATOM records): (download) 
    >6jl3A (A:)
mvinvsfkvtggkeftvaiepditvldlkkicaehvdipveaqriifkgkilkdkesltl
ygvadgntmhlvrs