PDB entry 6jk7

View 6jk7 on RCSB PDB site
Description: crystal structure of spae basal pilin from lactobacillus rhamnosus gg - trigonal form
Deposited on 2019-02-27, released 2019-06-26
The last revision was dated 2021-09-15, with a file datestamp of 2021-09-10.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pilus assembly protein
    Species: Lactobacillus rhamnosus (strain ATCC 53103 / GG) [TaxId:568703]
    Gene: DU507_12320
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A345U425 (7-391)
      • expression tag (0-6)
      • expression tag (392-399)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6jk7A (A:)
    mgrdpnsdqtaeivihkriyrdirqpedvwyendghridpnnpdkdgykllsktsglnga
    nfevydassllkpnmtpeairalvdryqnmtrkqalkfaranlklagqgnkgiglmntkn
    dptlgedgisritvsvdqqaptkaylmievapdpstelnvdlerksspmlvvfpvtdpis
    gnplqtihlypknvgyvrdpyffkfgvhpdgtskrlagaifaiyriengkklyldmspvt
    dlrnkwvsttdplhddrvnkfvsdqdglvntgerflpageyffeelqgvpgyevdaksra
    ikieipdswededgnrrfvlidgqpmqenfggvvtpemissgyprvynyadkqasttgdq
    tagpsttqlgnhgqdtngtgtrtpkrqsgylplehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6jk7A (A:)
    dqtaeivihkriyrdidpnnpdkdgykllsglnganfevydassllkpnmtpeairalvd
    ryqnmtrkqalkfaranlklagqgnkgiglmntkndptlgedgisritvsvdqqaptkay
    lmievapdpdlerksspmlvvfpvtdpisgnplqtihlypknvgyvrdpyffkfgvhpdg
    tskrlagaifaiyriengkklyldmspvtdlrnkwvsttdplhddrvnkfvsdqdglvnt
    gerflpageyffeelqgvpgyaikieipdswededgnrrfvlidgqpmqenfggvvtpem
    issgyprvynya