PDB entry 6jk4

View 6jk4 on RCSB PDB site
Description: Ca2+-dependent type II antifreeze protein
Class: antifreeze protein
Keywords: antifreeze protein, C-type lectin, ice-binding protein
Deposited on 2019-02-27, released 2019-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-26, with a file datestamp of 2019-06-21.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: N/A
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II antifreeze protein
    Species: Hypomesus nipponensis [TaxId:182223]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84493
      • engineered mutation (17)
    Domains in SCOPe 2.07: d6jk4a_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6jk4A (A:)
    hhhhhhadecptdwklfdgtcylfnpsvlhwadaqescmkegaslasihsleqytfvkel
    ttaaltpswlgggdcqvstrwfwmdgtsmdftdwcyaqpdttltecciqmnvgvgkcwdd
    tpcthlhssicaktst
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jk4A (A:)
    ecptdwklfdgtcylfnpsvlhwadaqescmkegaslasihsleqytfvkelttaaltps
    wlgggdcqvstrwfwmdgtsmdftdwcyaqpdttltecciqmnvgvgkcwddtpcthlhs
    sicakt