PDB entry 6jk3

View 6jk3 on RCSB PDB site
Description: crystal structure of a mini fungal lectin, phosl in complex with core- fucosylated chitobiose
Deposited on 2019-02-27, released 2020-03-04
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 1.12 Å
R-factor: N/A
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Pholiota squarrosa [TaxId:75321]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: lectin
    Species: Pholiota squarrosa [TaxId:75321]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: lectin
    Species: Pholiota squarrosa [TaxId:75321]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6jk3A (A:)
apvpvtklvcdgdtykctayldfgdgrwvaqwdtnvfhtg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6jk3B (B:)
apvpvtklvcdgdtykctayldfgdgrwvaqwdtnvfhtg

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >6jk3C (C:)
apvpvtklvcdgdtykctayldfgdgrwvaqwdtnvfhtg