PDB entry 6jk2

View 6jk2 on RCSB PDB site
Description: crystal structure of a mini fungal lectin, phosl
Deposited on 2019-02-27, released 2020-03-04
The last revision was dated 2020-03-04, with a file datestamp of 2020-02-28.
Experiment type: XRAY
Resolution: 1.06 Å
R-factor: N/A
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Pholiota squarrosa [TaxId:75321]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6jk2A (A:)
    apvpvtklvcdgdtykctayldfgdgrwvaqwdtnvfhtg