PDB entry 6jk0

View 6jk0 on RCSB PDB site
Description: crystal structure of yap1 and dendrin complex
Deposited on 2019-02-27, released 2019-09-25
The last revision was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional coactivator YAP1,Dendrin
    Species: Mus musculus [TaxId:10090]
    Gene: Ddn, Gm748, Kiaa0749
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46938 (20-111)
      • expression tag (4-19)
    • Uniprot Q80TS7 (112-131)
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6jk0A (A:)
mhhhhhhssglevlfqgpgsvplpagwemaktssgqryflnhndqtttwqdprkamlsql
nvpapaspavpqtlmnsasgplpdgweqamtqdgevyyinhknkttswldprdrpppyva
ppsyegphrtlg

    Sequence, based on observed residues (ATOM records):
    >6jk0A (A:)
hhhssglevlfqgpgsvplpagwemaktssgqryflnhndqtttwqdprkamlsqlnvsg
plpdgweqamtqdgevyyinhknkttswldprdrpppyvappsyegphrtlg