PDB entry 6jjw

View 6jjw on RCSB PDB site
Description: crystal structure of kibra and ptpn14 complex
Deposited on 2019-02-27, released 2019-09-25
The last revision was dated 2019-09-25, with a file datestamp of 2019-09-20.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein KIBRA
    Species: Mus musculus [TaxId:10090]
    Gene: WWC1, KIAA0869
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Peptide from Tyrosine-protein phosphatase non-receptor type 14
    Species: Homo sapiens [TaxId:9606]
    Gene: PTPN14, PEZ, PTPD2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, FMT, GOL, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6jjwA (A:)
gpgsefelplpegweeardfdgkvyyidhrnrttswidprdrytkpltfadcisdelplg
weeaydpqvgdyfidhntkttqiedprvqwrreqehmlkdylvvaqealsaqkeiyqvkq
qrlelaqqeyqqlh

    Sequence, based on observed residues (ATOM records):
    >6jjwA (A:)
lplpegweeardfdgkvyyidhrnrttswidprdrytkpltfadcisdelplgweeaydp
qvgdyfidhntkttqiedprvqwrreqeh

  • Chain 'U':
    Sequence, based on SEQRES records:
    >6jjwU (U:)
gpgsshrhsaiivpsyrptpdyetvmrqmkrg

    Sequence, based on observed residues (ATOM records):
    >6jjwU (U:)
iivpsyrptpdyetvmrqmk