PDB entry 6jjj

View 6jjj on RCSB PDB site
Description: Trimeric structure of Kupffer cell C-type lectin receptor Clec4f
Class: sugar binding protein
Keywords: C-type lectin receptor, Clec4f, Kupffer cell receptor, SUGAR BINDING PROTEIN
Deposited on 2019-02-26, released 2019-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-type lectin domain family 4 member F
    Species: Mus musculus [TaxId:10090]
    Gene: Clec4f, Clecsf13, Kclr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jjja_
  • Chain 'B':
    Compound: C-type lectin domain family 4 member F
    Species: Mus musculus [TaxId:10090]
    Gene: Clec4f, Clecsf13, Kclr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jjjb_
  • Chain 'C':
    Compound: C-type lectin domain family 4 member F
    Species: Mus musculus [TaxId:10090]
    Gene: Clec4f, Clecsf13, Kclr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jjjc_
  • Chain 'D':
    Compound: C-type lectin domain family 4 member F
    Species: Mus musculus [TaxId:10090]
    Gene: Clec4f, Clecsf13, Kclr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jjjd_
  • Chain 'E':
    Compound: C-type lectin domain family 4 member F
    Species: Mus musculus [TaxId:10090]
    Gene: Clec4f, Clecsf13, Kclr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jjje_
  • Chain 'F':
    Compound: C-type lectin domain family 4 member F
    Species: Mus musculus [TaxId:10090]
    Gene: Clec4f, Clecsf13, Kclr
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jjjf_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6jjjA (A:)
    galqeavaaqkqeqktqnqvlqliaqnwkyfngnfyyfsrdkkpwreaekfctsqgahla
    svtsqeeqaflvqttssgdhwigltdqgtegiwrwvdgtpfnnaqskgfwgknqpdnwrh
    rngeredcvhvrqqwndmacgssypwvckkstgwsaarvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jjjA (A:)
    eavaaqkqeqktqnqvlqliaqnwkyfngnfyyfsrdkkpwreaekfctsqgahlasvts
    qeeqaflvqttssgdhwigltdqgtegiwrwvdgtpfnnaqskgfwgknqpdnwrhrnge
    redcvhvrqqwndmacgssypwvckkstgws
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6jjjB (B:)
    galqeavaaqkqeqktqnqvlqliaqnwkyfngnfyyfsrdkkpwreaekfctsqgahla
    svtsqeeqaflvqttssgdhwigltdqgtegiwrwvdgtpfnnaqskgfwgknqpdnwrh
    rngeredcvhvrqqwndmacgssypwvckkstgwsaarvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jjjB (B:)
    eavaaqkqeqktqnqvlqliaqnwkyfngnfyyfsrdkkpwreaekfctsqgahlasvts
    qeeqaflvqttssgdhwigltdqgtegiwrwvdgtpfnnaqskgfwgknqpdnwrhrnge
    redcvhvrqqwndmacgssypwvckkstgws
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6jjjC (C:)
    galqeavaaqkqeqktqnqvlqliaqnwkyfngnfyyfsrdkkpwreaekfctsqgahla
    svtsqeeqaflvqttssgdhwigltdqgtegiwrwvdgtpfnnaqskgfwgknqpdnwrh
    rngeredcvhvrqqwndmacgssypwvckkstgwsaarvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jjjC (C:)
    eavaaqkqeqktqnqvlqliaqnwkyfngnfyyfsrdkkpwreaekfctsqgahlasvts
    qeeqaflvqttssgdhwigltdqgtegiwrwvdgtpfnnaqskgfwgknqpdnwrhrnge
    redcvhvrqqwndmacgssypwvckkstgws
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6jjjD (D:)
    galqeavaaqkqeqktqnqvlqliaqnwkyfngnfyyfsrdkkpwreaekfctsqgahla
    svtsqeeqaflvqttssgdhwigltdqgtegiwrwvdgtpfnnaqskgfwgknqpdnwrh
    rngeredcvhvrqqwndmacgssypwvckkstgwsaarvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jjjD (D:)
    eavaaqkqeqktqnqvlqliaqnwkyfngnfyyfsrdkkpwreaekfctsqgahlasvts
    qeeqaflvqttssgdhwigltdqgtegiwrwvdgtpfnnaqskgfwgknqpdnwrhrnge
    redcvhvrqqwndmacgssypwvckkstgws
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6jjjE (E:)
    galqeavaaqkqeqktqnqvlqliaqnwkyfngnfyyfsrdkkpwreaekfctsqgahla
    svtsqeeqaflvqttssgdhwigltdqgtegiwrwvdgtpfnnaqskgfwgknqpdnwrh
    rngeredcvhvrqqwndmacgssypwvckkstgwsaarvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jjjE (E:)
    eavaaqkqeqktqnqvlqliaqnwkyfngnfyyfsrdkkpwreaekfctsqgahlasvts
    qeeqaflvqttssgdhwigltdqgtegiwrwvdgtpfnnaqskgfwgknqpdnwrhrnge
    redcvhvrqqwndmacgssypwvckkstgws
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >6jjjF (F:)
    galqeavaaqkqeqktqnqvlqliaqnwkyfngnfyyfsrdkkpwreaekfctsqgahla
    svtsqeeqaflvqttssgdhwigltdqgtegiwrwvdgtpfnnaqskgfwgknqpdnwrh
    rngeredcvhvrqqwndmacgssypwvckkstgwsaarvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jjjF (F:)
    eavaaqkqeqktqnqvlqliaqnwkyfngnfyyfsrdkkpwreaekfctsqgahlasvts
    qeeqaflvqttssgdhwigltdqgtegiwrwvdgtpfnnaqskgfwgknqpdnwrhrnge
    redcvhvrqqwndmacgssypwvckkstgws