PDB entry 6jiz

View 6jiz on RCSB PDB site
Description: apo structure of an imine reductase at 1.76 angstrom resolution
Deposited on 2019-02-24, released 2020-02-26
The last revision was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphogluconate dehydrogenase NAD-binding protein
    Species: Stackebrandtia nassauensis DSM 44728 [TaxId:446470]
    Gene: Snas_4330
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 6-phosphogluconate dehydrogenase NAD-binding protein
    Species: Stackebrandtia nassauensis DSM 44728 [TaxId:446470]
    Gene: Snas_4330
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 6-phosphogluconate dehydrogenase NAD-binding protein
    Species: Stackebrandtia nassauensis DSM 44728 [TaxId:446470]
    Gene: Snas_4330
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, CL, NH4, NA, LW9, NAP, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6jizA (A:)
    mnskkspvtliglgpmgqamvrtllgqghpvtvwnrtpsraeplvvegarlaaspteava
    ssdlvilsltdyqamydilstaesalagrtivnlssddpdvtreaakwaakhgatfiagg
    vmtpaptvgteaayvfysgpksafdahepvlrhiggprflgedtglaqlyylahldvflt
    tlasvvhatalvsaagvdeaafapeairmvietgqmlaaeaetglelgrnlasgnhpgel
    atavmmgatadhivsaakgsgvdlvlpeavkslydrtvaaghgkdswtamyeiikkkaa
    

    Sequence, based on observed residues (ATOM records):
    >6jizA (A:)
    kspvtliglgpmgqamvrtllgqghpvtvwnrtpsraeplvvegarlaaspteavassdl
    vilsltdyqamydilstaesalagrtivnlssddpdvtreaakwaakhgatfiaggvmtp
    aptvgteaayvfysgpksafdahepvlrhiggprflgedtglaqlyylahldvflttlas
    vvhatalvsaagvdeaafapeairmvietgqmlaaeaetglelgrnlasgnhpgelatav
    mmgatadhivsaakgsgvdlvlpeavkslydrtvaaghgkdswtamyeiikkk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6jizB (B:)
    mnskkspvtliglgpmgqamvrtllgqghpvtvwnrtpsraeplvvegarlaaspteava
    ssdlvilsltdyqamydilstaesalagrtivnlssddpdvtreaakwaakhgatfiagg
    vmtpaptvgteaayvfysgpksafdahepvlrhiggprflgedtglaqlyylahldvflt
    tlasvvhatalvsaagvdeaafapeairmvietgqmlaaeaetglelgrnlasgnhpgel
    atavmmgatadhivsaakgsgvdlvlpeavkslydrtvaaghgkdswtamyeiikkkaa
    

    Sequence, based on observed residues (ATOM records):
    >6jizB (B:)
    kspvtliglgpmgqamvrtllgqghpvtvwnrtpsraeplvvegarlaaspteavassdl
    vilsltdyqamydilstaesalagrtivnlssddpdvtreaakwaakhgatfiaggvmtp
    aptvgteaayvfysgpksafdahepvlrhiggprflgedtglaqlyylahldvflttlas
    vvhatalvsaagvdeaafapeairmvietgqmlaaeaetglelgrnlasgnhpgelatav
    mmgatadhivsaakgsgvdlvlpeavkslydrtvaaghgkdswtamyeiikkk
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >6jizC (C:)
    mnskkspvtliglgpmgqamvrtllgqghpvtvwnrtpsraeplvvegarlaaspteava
    ssdlvilsltdyqamydilstaesalagrtivnlssddpdvtreaakwaakhgatfiagg
    vmtpaptvgteaayvfysgpksafdahepvlrhiggprflgedtglaqlyylahldvflt
    tlasvvhatalvsaagvdeaafapeairmvietgqmlaaeaetglelgrnlasgnhpgel
    atavmmgatadhivsaakgsgvdlvlpeavkslydrtvaaghgkdswtamyeiikkkaa
    

    Sequence, based on observed residues (ATOM records):
    >6jizC (C:)
    kkspvtliglgpmgqamvrtllgqghpvtvwnrtpsraeplvvegarlaaspteavassd
    lvilsltdyqamydilstaesalagrtivnlssddpdvtreaakwaakhgatfiaggvmt
    paptvgteaayvfysgpksafdahepvlrhiggprflgedtglaqlyylahldvflttla
    svvhatalvsaagvdeaafapeairmvietgqmlaaeaetglelgrnlasgnhpgelata
    vmmgatadhivsaakgsgvdlvlpeavkslydrtvaaghgkdswtamyeiikkka