PDB entry 6jip

View 6jip on RCSB PDB site
Description: crystal structure of streptococcus pneumoniae sp_0782 (residues 7-79) in complex with single-stranded dna dt6
Deposited on 2019-02-22, released 2019-11-27
The last revision was dated 2020-01-22, with a file datestamp of 2020-01-17.
Experiment type: XRAY
Resolution: 1.66 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sp_0782
    Species: Streptococcus pneumoniae (strain ATCC BAA-255 / R6) [TaxId:171101]
    Gene: spr0690, sp_0782
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA (5'-d(*tp*tp*tp*tp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: 1PE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6jipA (A:)
    mkkmaeftfeieehlltlsenekgwtkeinrvsfngapakfdirawspdhtkmgkgitls
    neefqtmvdafkgnlehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >6jipA (A:)
    eftfeieehlltlsenekgwtkeinrvsfngapakfdirawspdhtkmgkgitlsneefq
    tmvdafk
    

  • Chain 'B':
    No sequence available.