PDB entry 6jic

View 6jic on RCSB PDB site
Description: Identification and Characterization of a carboxypeptidase inhibitor from Lycium barbarum
Class: plant protein
Keywords: carboxypeptidase inhibitor, wolfberry, cysteine-rich peptide, PLANT PROTEIN
Deposited on 2019-02-20, released 2020-02-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-10, with a file datestamp of 2021-03-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: wci
  Species: Lycium barbarum [TaxId:112863]
  Database cross-references and differences (RAF-indexed):
  • PDB 6JIC (0-35)
  Domains in SCOPe 2.08: d6jica_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6jicA (A:)
  qddptcgkpcntmddcsngwfcqacwnsrktcgpfv