PDB entry 6jia

View 6jia on RCSB PDB site
Description: Marine bacterial laminarinase mutant E135A complex with laminaritetraose
Class: hydrolase
Keywords: Hydrolase
Deposited on 2019-02-20, released 2019-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-05-06, with a file datestamp of 2020-05-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Laminarinase
    Species: Aquimarina sp. [TaxId:1872586]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JIA
    Domains in SCOPe 2.07: d6jiaa_
  • Heterogens: CA, BGC, GLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6jiaA (A:)
    mqnwtlvwqdeftngissdwvfetgngnsgwgnnelqyyrrenatvengnlvitakresi
    ggynytstrmktqgrkswkygkveariampsfmgswpafwmlgdnissvgwpacgaidim
    ehvnteaqthgtihwqdhnntyanysgsipvssvtsyhiytiewdasvikwfvdgnlyhe
    asiangvngtsefhnnffillnmaiggnwpgfnidnnafparmlvdyvrvyqktdlehhh
    hhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jiaA (A:)
    nwtlvwqdeftngissdwvfetgngnsgwgnnelqyyrrenatvengnlvitakresigg
    ynytstrmktqgrkswkygkveariampsfmgswpafwmlgdnissvgwpacgaidimeh
    vnteaqthgtihwqdhnntyanysgsipvssvtsyhiytiewdasvikwfvdgnlyheas
    iangvngtsefhnnffillnmaiggnwpgfnidnnafparmlvdyvrvyqk