PDB entry 6jhz

View 6jhz on RCSB PDB site
Description: crystal structure of cas2
Deposited on 2019-02-19, released 2020-03-25
The last revision was dated 2020-03-25, with a file datestamp of 2020-03-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CRISPR-associated endoribonuclease Cas2
    Species: Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) [TaxId:243275]
    Gene: cas2, TDE_0329
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: CRISPR-associated endoribonuclease Cas2
    Species: Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) [TaxId:243275]
    Gene: cas2, TDE_0329
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: 5-mer peptide
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JHZ (0-4)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6jhzA (A:)
mrvivffdlpvitpenrhnysvfrkyliksgfimqqksvysklvlnltnrdsivksiekn
kppeglvevltvtekqyakmeiiigeskteyln

  • Chain 'B':
    Sequence, based on SEQRES records:
    >6jhzB (B:)
mrvivffdlpvitpenrhnysvfrkyliksgfimqqksvysklvlnltnrdsivksiekn
kppeglvevltvtekqyakmeiiigeskteyln

    Sequence, based on observed residues (ATOM records):
    >6jhzB (B:)
rvivffdlpvitpenrhnysvfrkyliksgfimqqksvysklvlnltnrdsivksieknk
ppeglvevltvtekqyakmeiiigeskteyl

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records:
    >6jhzQ (Q:)
ggggg