PDB entry 6jhe

View 6jhe on RCSB PDB site
Description: crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna
Deposited on 2019-02-18, released 2020-01-01
The last revision was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ECF RNA polymerase sigma factor SigW
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: sigW, ybbL, BSU01730
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA (5'-d(p*tp*tp*gp*ap*ap*ap*cp*cp*tp*tp*t)-3')
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'C':
    Compound: DNA (5'-d(*ap*ap*ap*gp*gp*tp*tp*tp*cp*ap*a)-3')
    Species: synthetic construct, synthetic [TaxId:32630]

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6jheA (A:)
gslsntiqqkilklpdkyrtvivlkyidelslieigeilnipvgtvktrihrgrealrkq
lrdl

    Sequence, based on observed residues (ATOM records):
    >6jheA (A:)
ilklpdkyrtvivlkyidelslieigeilnipvgtvktrihrgrealrkqlrd

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.