PDB entry 6jhd

View 6jhd on RCSB PDB site
Description: Solution structure of IFN alpha8
Class: cytokine
Keywords: Interferon alpha8, CYTOKINE
Deposited on 2019-02-18, released 2020-02-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon alpha-8
    Species: Homo sapiens [TaxId:9606]
    Gene: IFNA8
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jhda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6jhdA (A:)
cdlpqthslgnrralillaqmrrispfsclkdrhdfefpqeefddkqfqkaqaisvlhem
iqqtfnlfstkdssaaldetlldefyieldqqlndlescvmqevgviesplmyedsilav
rkyfqritlyltekkysscawevvraeimrsfslsinlqkrlkske