PDB entry 6jh0

View 6jh0 on RCSB PDB site
Description: Crystal structure of cISG15/NS1B complex
Class: antiviral protein
Keywords: Complex, Antiviral, ANTIVIRAL PROTEIN
Deposited on 2019-02-16, released 2019-10-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-structural protein 1
    Species: Influenza B virus (strain B/Lee/1940) [TaxId:518987]
    Gene: NS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jh0a_
  • Chain 'B':
    Compound: ISG15 ubiquitin-like modifier
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: ISG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot E2R7R1
      • engineered mutation (83)
    Domains in SCOPe 2.07: d6jh0b1, d6jh0b2
  • Chain 'C':
    Compound: Non-structural protein 1
    Species: Influenza B virus (strain B/Lee/1940) [TaxId:518987]
    Gene: NS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6jh0c_
  • Chain 'D':
    Compound: ISG15 ubiquitin-like modifier
    Species: Canis lupus familiaris [TaxId:9615]
    Gene: ISG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot E2R7R1
      • engineered mutation (83)
    Domains in SCOPe 2.07: d6jh0d1, d6jh0d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6jh0A (A:)
    madnmtttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrik
    thnksepenkrmsleerkaigvkmmkvllfmdpsagiegfepy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jh0A (A:)
    qievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepe
    nkrmsleerkaigvkmmkvllfmdpsagiegfep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6jh0B (B:)
    mleptamagnltvkmlggeeflvplrdsmlaselkqqialktgvpafqqrlathpagtvl
    qdgislirqglcpgstvllvvknsndplsilvrnnkgrsiayevwltqtvaelkqqvcqq
    ehvqadlfwltfegkpmedkhqlgeygltpqctvfmnlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jh0B (B:)
    gnltvkmlggeeflvplrdsmlaselkqqialktgvpafqqrlathpagtvlqdgislir
    qglcpgstvllvvknsndplsilvrnnkgrsiayevwltqtvaelkqqvcqqehvqadlf
    wltfegkpmedkhqlgeygltpqctvfmnlrlr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6jh0C (C:)
    madnmtttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrik
    thnksepenkrmsleerkaigvkmmkvllfmdpsagiegfepy
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jh0C (C:)
    qievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnksepe
    nkrmsleerkaigvkmmkvllfmdpsagiegfep
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6jh0D (D:)
    mleptamagnltvkmlggeeflvplrdsmlaselkqqialktgvpafqqrlathpagtvl
    qdgislirqglcpgstvllvvknsndplsilvrnnkgrsiayevwltqtvaelkqqvcqq
    ehvqadlfwltfegkpmedkhqlgeygltpqctvfmnlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jh0D (D:)
    gnltvkmlggeeflvplrdsmlaselkqqialktgvpafqqrlathpagtvlqdgislir
    qglcpgstvllvvknsndplsilvrnnkgrsiayevwltqtvaelkqqvcqqehvqadlf
    wltfegkpmedkhqlgeygltpqctvfmnlrlr