PDB entry 6jgy

View 6jgy on RCSB PDB site
Description: crystal structure of lasv-gp2 in a post fusion conformation
Deposited on 2019-02-15, released 2019-09-11
The last revision was dated 2019-09-11, with a file datestamp of 2019-09-06.
Experiment type: XRAY
Resolution: 3.39 Å
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pre-glycoprotein polyprotein GP complex
    Species: Lassa mammarenavirus [TaxId:11620]
    Gene: GP, GPC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GWS0 (4-End)
      • conflict (8)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6jgyA (A:)
gphmdeefsdmlrlfdfnkqaiqrlkaeaqmsiqlinkavnalindqlimknhlrdimgi
pycnyskywylnhttttslpkcwlvsngsylnethfsddieqqadnmitemlqkeymerq
gktplglvd

    Sequence, based on observed residues (ATOM records):
    >6jgyA (A:)
deefsdmlrlfdfnkqaiqrlkaeaqmsiqlinkavnalindqlimknhlrdimgipycn
yskywylnhpkcwlvsngsylnethfsddieqqadnmitemlqke