PDB entry 6jgv

View 6jgv on RCSB PDB site
Description: Crystal structure of the transcriptional regulator CadR from P. putida
Class: transcription
Keywords: CadR, MerR family, cadmium regulator, TRANSCRIPTION
Deposited on 2019-02-15, released 2019-09-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-23, with a file datestamp of 2019-10-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CadR
    Species: Pseudomonas putida [TaxId:303]
    Gene: cadR, BIW19_10095, BL240_26950
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jgva_
  • Chain 'B':
    Compound: CadR
    Species: Pseudomonas putida [TaxId:303]
    Gene: cadR, BIW19_10095, BL240_26950
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jgvb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6jgvA (A:)
    mkigelakatdcavetiryyereqllpeparsdgnyrlytqahverltfirncrtldmtl
    deirsllrlrdspddscgsvnalidehiehvqaridglvalqeqlvelrrrcnaqgaeca
    ilqqletngavsvpetehshvgrshgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jgvA (A:)
    mkigelakatdcavetiryyereqllpeplytqahverltfirncrtldmtldeirsllr
    lrdspddsgsvnalidehiehvqaridglvalqeqlvelrrrcnaqgaecailqqletn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6jgvB (B:)
    mkigelakatdcavetiryyereqllpeparsdgnyrlytqahverltfirncrtldmtl
    deirsllrlrdspddscgsvnalidehiehvqaridglvalqeqlvelrrrcnaqgaeca
    ilqqletngavsvpetehshvgrshgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jgvB (B:)
    mkigelakatdcavetiryyereqllpeplytqahverltfirncrtldmtldeirsllr
    lrdspddsgsvnalidehiehvqaridglvalqeqlvelrrrcnaqgaecailqqletn