PDB entry 6jgq

View 6jgq on RCSB PDB site
Description: Crystal structure of barley exohydrolaseI W434Y mutant in complex with methyl 2-thio-beta-sophoroside.
Class: hydrolase
Keywords: Barley exohydrolaseI, Hydrolase, enzyme function
Deposited on 2019-02-14, released 2020-08-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-08-19, with a file datestamp of 2020-08-14.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-d-glucan glucohydrolase isoenzyme exo1
    Species: Hordeum vulgare subsp. vulgare [TaxId:112509]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A287SCR5 (4-End)
      • expression tag (0-3)
      • conflict (323)
      • engineered mutation (437)
    Domains in SCOPe 2.07: d6jgqa1, d6jgqa2, d6jgqa3
  • Heterogens: BGC, U2A, NAG, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6jgqA (A:)
    hhaadyvlykdatkpvedrvadllgrmtlaekigqmtqierlvatpdvlrdnfigsllsg
    ggsvprkgatakewqdmvdgfqkacmstrlgipmiygidavhgqnnvygatifphnvglg
    atrdpylvkrigeatalevratgiqyafapciavcrdprwgrcyesysedrrivqsmtel
    ipglqgdvpkdftsgmpfvagknkvaacakhfvgdggtvdginenntiinreglmnihmp
    ayknamdkgvstvmisysswngvkmhanqdlvtgylkdtlkfkgfvisdwegidrittpa
    gsdysysvkasilagldmimvpnkyqqfisiltghvnggvipmsriddavtrilrvkftm
    glfenpyadpamaeqlgkqehrdlareaarkslvllkngktstdapllplpkkapkilva
    gshadnlgyqcggwtieyqgdtgrttvgttileavkaavdpstvvvfaenpdaefvksgg
    fsyaivavgehpytetkgdnlnltipepglstvqavcggvrcatvlisgrpvvvqpllaa
    sdalvaawlpgsegqgvtdalfgdfgftgrlprtwfksvdqlpmnvgdahydplfrlgyg
    lttnatkky
    

    Sequence, based on observed residues (ATOM records): (download)
    >6jgqA (A:)
    hhaadyvlykdatkpvedrvadllgrmtlaekigqmtqierlvatpdvlrdnfigsllsg
    ggsvprkgatakewqdmvdgfqkacmstrlgipmiygidavhgqnnvygatifphnvglg
    atrdpylvkrigeatalevratgiqyafapciavcrdprwgrcyesysedrrivqsmtel
    ipglqgdvpkdftsgmpfvagknkvaacakhfvgdggtvdginenntiinreglmnihmp
    ayknamdkgvstvmisysswngvkmhanqdlvtgylkdtlkfkgfvisdwegidrittpa
    gsdysysvkasilagldmimvpnkyqqfisiltghvnggvipmsriddavtrilrvkftm
    glfenpyadpamaeqlgkqehrdlareaarkslvllkngktstdapllplpkkapkilva
    gshadnlgyqcggwtieyqgdtgrttvgttileavkaavdpstvvvfaenpdaefvksgg
    fsyaivavgehpytetkgdnlnltipepglstvqavcggvrcatvlisgrpvvvqpllaa
    sdalvaawlpgsegqgvtdalfgdfgftgrlprtwfksvdqlpmnvgdahydplfrlgyg
    lttnat