PDB entry 6jfr

View 6jfr on RCSB PDB site
Description: K3U bound crystal structure of class II peptide deformylase from methicillin resistant Staphylococcus aureus
Class: hydrolase
Keywords: peptide deformylase, hydrolase
Deposited on 2019-02-11, released 2020-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-12, with a file datestamp of 2020-02-07.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide deformylase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: def, def1, pdf1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jfra_
  • Heterogens: K3U, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6jfrA (A:)
mltmkdiirdghptlrqkaaelelpltkeeketliamreflvnsqdeeiakryglrsgvg
laapqiniskrmiavlipddgsgksydymlvnpkivshsvqeaylptgegclsvddnvag
lvhrhnritikakdiegndiqlrlkgypaivfqheidhlngvmfydhidknhplqphtda
vev