PDB entry 6jfo

View 6jfo on RCSB PDB site
Description: formyl-met-ala-ser bound crystal structure of class ii peptide deformylase from methicillin resistant staphylococcus aureus
Deposited on 2019-02-11, released 2020-02-12
The last revision was dated 2020-02-12, with a file datestamp of 2020-02-07.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide deformylase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: def, def1, pdf1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: fme-ala-ser
    Species: synthetic construct, synthetic [TaxId:3702]
    Database cross-references and differences (RAF-indexed):
    • PDB 6JFO (0-2)
  • Heterogens: FME, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6jfoA (A:)
    mltmkdiirdghptlrqkaaelelpltkeeketliamreflvnsqdeeiakryglrsgvg
    laapqiniskrmiavlipddgsgksydymlvnpkivshsvqeaylptgegclsvddnvag
    lvhrhnritikakdiegndiqlrlkgypaivfqheidhlngvmfydhidknhplqphtda
    vev
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >6jfoB (B:)
    mas