PDB entry 6jex

View 6jex on RCSB PDB site
Description: K4U bound crystal peptide deformylase from Acinetobacter baumanii
Class: hydrolase
Keywords: peptide deformylase, hydrolase
Deposited on 2019-02-07, released 2020-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-12, with a file datestamp of 2020-02-07.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide deformylase
    Species: Acinetobacter baumannii MRSN 3527 [TaxId:1409923]
    Gene: def_1, def, T630_0214,K0420859
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jexa_
  • Chain 'B':
    Compound: Peptide deformylase
    Species: Acinetobacter baumannii MRSN 3527 [TaxId:1409923]
    Gene: def_1, def, T630_0214,K0420859
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jexb_
  • Heterogens: LHY, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6jexA (A:)
allpilsfpdprlrtiakpveevtdeirqlaadmfetmyaapgiglaasqvdrhiqlivm
dlseskdepmvfinpkvtplteetqpyeegclsvpqiydkvdrpsrvkieainlegqafe
ieadgllavciqhemdhlngklfvdylsplkrqrarekvekivrqrerekva

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >6jexB (B:)
allpilsfpdprlrtiakpveevtdeirqlaadmfetmyaapgiglaasqvdrhiqlivm
dlseskdepmvfinpkvtplteetqpyeegclsvpqiydkvdrpsrvkieainlegqafe
ieadgllavciqhemdhlngklfvdylsplkrqrarekvekivrqrerekva