PDB entry 6jeu

View 6jeu on RCSB PDB site
Description: K1U bound crystal peptide deformylase from Acinetobacter baumanii
Class: hydrolase
Keywords: peptide deformylase, hydrolase
Deposited on 2019-02-07, released 2020-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-12, with a file datestamp of 2020-02-07.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptide deformylase
    Species: Acinetobacter baumannii MRSN 3527 [TaxId:1409923]
    Gene: def_1, def, T630_0214
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jeua_
  • Chain 'B':
    Compound: Peptide deformylase
    Species: Acinetobacter baumannii MRSN 3527 [TaxId:1409923]
    Gene: def_1, def, T630_0214
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6jeub_
  • Heterogens: K1U, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6jeuA (A:)
    allpilsfpdprlrtiakpveevtdeirqlaadmfetmyaapgiglaasqvdrhiqlivm
    dlseskdepmvfinpkvtplteetqpyeegclsvpqiydkvdrpsrvkieainlegqafe
    ieadgllavciqhemdhlngklfvdylsplkrqrarekvekivrqrerek
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6jeuB (B:)
    allpilsfpdprlrtiakpveevtdeirqlaadmfetmyaapgiglaasqvdrhiqlivm
    dlseskdepmvfinpkvtplteetqpyeegclsvpqiydkvdrpsrvkieainlegqafe
    ieadgllavciqhemdhlngklfvdylsplkrqrarekvekivrqrerek