PDB entry 6jdv

View 6jdv on RCSB PDB site
Description: crystal structure of nme1cas9 in complex with sgrna and target dna (atatgatt pam) in catalytic state
Deposited on 2019-02-02, released 2019-11-06
The last revision was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CRISPR-associated endonuclease Cas9
    Species: Neisseria meningitidis serogroup C (strain 8013) [TaxId:604162]
    Gene: cas9, NMV_1993
    Database cross-references and differences (RAF-indexed):
    • Uniprot C9X1G5 (Start-1082)
      • engineered mutation (588)
  • Chain 'B':
    Compound: sgrna
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'C':
    Compound: target DNA strand
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'D':
    Compound: non-target DNA strand
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: MG, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >6jdvA (A:)
    smaafkpnsinyilgldigiasvgwamveideeenpirlidlgvrvferaevpktgdsla
    marrlarsvrrltrrrahrllrtrrllkregvlqaanfdenglikslpntpwqlraaald
    rkltplewsavllhlikhrgylsqrknegetadkelgallkgvagnahalqtgdfrtpae
    lalnkfekesghirnqrsdyshtfsrkdlqaelillfekqkefgnphvsgglkegietll
    mtqrpalsgdavqkmlghctfepaepkaakntytaerfiwltklnnlrileqgserpltd
    teratlmdepyrkskltyaqarkllgledtaffkglrygkdnaeastlmemkayhaisra
    lekeglkdkksplnlspelqdeigtafslfktdeditgrlkdriqpeileallkhisfdk
    fvqislkalrrivplmeqgkrydeacaeiygdhygkknteekiylppipadeirnpvvlr
    alsqarkvingvvrrygsparihietarevgksfkdrkeiekrqeenrkdrekaaakfre
    yfpnfvgepkskdilklrlyeqqhgkclysgkeinlgrlnekgyveidaalpfsrtwdds
    fnnkvlvlgsenqnkgnqtpyeyfngkdnsrewqefkarvetsrfprskkqrillqkfde
    dgfkernlndtryvnrflcqfvadrmrltgkgkkrvfasngqitnllrgfwglrkvraen
    drhhaldavvvacstvamqqkitrfvrykemnafdgktidketgevlhqkthfpqpweff
    aqevmirvfgkpdgkpefeeadtleklrtllaeklssrpeavheyvtplfvsrapnrkms
    gqghmetvksakrldegvsvlrvpltqlklkdlekmvnrerepklyealkarleahkddp
    akafaepfykydkagnrtqqvkavrveqvqktgvwvrnhngiadnatmvrvdvfekgdky
    ylvpiyswqvakgilpdravvqgkdeedwqliddsfnfkfslhpndlvevitkkarmfgy
    faschrgtgninirihdldhkigkngilegigvktalsfqkyqidelgkeirpcrlkkrp
    pvr
    

    Sequence, based on observed residues (ATOM records):
    >6jdvA (A:)
    sinyilgldigiasvgwamveideeenpirlidlgvrvferaedslamarrlarsvrrlt
    rrrahrllrtrrllkregvlqaanfdenglikslpntpwqlraaaldrkltplewsavll
    hlikhrgylsqrkndfrtpaelalnkfekesghirnqrsdyshtfsrkdlqaelillfek
    qkefgnphvsgglkegietllmtqrpalsgdavqkmlghctfepaepkaakntytaerfi
    wltklnnlrileqgserpltdteratlmdepyrkskltyaqarkllgledtaffkglryg
    kdnaeastlmemkayhaisralekeglkdkksplnlspelqdeigtafslfktdeditgr
    lkdriqpeileallkhisfdkfvqislkalrrivplmeqgkrydeacaeiygdhygkknt
    eekiylppipadeirnpvvlralsqarkvingvvrrygsparihietarevgksfkdrke
    iekrqeenrkdrekaaakfreyfpnfvgepkskdilklrlyeqqhgkclysgkeinlgrl
    nekgyveidaalpfsrtwddsfnnkvlvlgsenqnkgnqtpyeyfngkdnsrewqefkar
    vetsrfprskkqrillqkfdrnlndtryvnrflcqfvadrmrltgkgkkrvfasngqitn
    llrgfwglrkvraendrhhaldavvvacstvamqqkitrfvrykemnafdgktidtgevl
    hqkthfpqpweffaqevmirvfgkpdgkpefeeadtleklrtllaeklssrpeavheyvt
    plfvsrapnrkmsgqghmetvksakrldegvsvlrvpltqlklkdlekmvnrerepklye
    alkarleahkddpakafaepfykydkagnrtqqvkavrveqvqktgvwvrnhngiadnat
    mvrvdvfekgdkyylvpiyswqvakgilpdravvqgkdeedwqliddsfnfkfslhpndl
    vevitkkarmfgyfaschrgtgninirihdldhkigkngilegigvktalsfqkyqidel
    gkeirpcrlkkrppvr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.