PDB entry 6jdb

View 6jdb on RCSB PDB site
Description: crystal structure of n-acetyl mannosmaine kinase in complex with mannac-6p and adp from haemophilus influenzae
Deposited on 2019-02-01, released 2020-02-05
The last revision was dated 2020-12-16, with a file datestamp of 2020-12-11.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-acetylmannosamine kinase
    Species: Haemophilus influenzae 86-028NP [TaxId:281310]
    Gene: nanK
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ADP, BMX, ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >6jdbA (A:)
mrclaldiggtkiaaaivkneieqrqqihtprenvvegmhqalgklladyegqfdyvava
stgiinngilsalnpknlgglaefplkasiakhtdkpigllndaqaatyaeyqlqnfeqv
snfvfitvstgvgggivlnqilqtgsrgiaghightladpngaicgcgrrgcveaiasgr
aieavssqwedpcdpkevferfrkndekatalversakaianliadlvisldiqkiaigg
svglaegylslvekylqdfpsiycceietakfgqdagligaaywvkdvll